Recombinant Rat Matrilysin (MMP7) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03337P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Matrilysin (MMP7) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03337P
Collections: Enzymes, Featured enzyme molecules, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Matrilysin (MMP7) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P50280 |
Target Symbol | MMP7 |
Synonyms | Mmp7; Mmp-7Matrilysin; EC 3.4.24.23; Matrin; Matrix metalloproteinase-7; MMP-7; Pump-1 protease; Uterine metalloproteinase |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL |
Expression Range | 98-267aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 45.9kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Protein Families | Peptidase M10A family |
Database References |
Gene Functions References
- Placental ischemia, possibly through the release of TNF-alpha, causes increases in the levels of matrix metalloproteinase (MMP)-1 and MMP-7, which could alter collagen deposition and cause inadequate uteroplacental and vascular remodeling in hypertension in pregnancy. PMID: 28626073
- Expression of MMP-7, c-Jun and c-Fos were increased in skin photoaging. PMID: 23870463
- Increased extracellular nerve growth factor precursor levels following seizures are stabilized by altered MMP-7 enzymatic activity, leading to increased neuronal death via activation of p75(NTR). PMID: 22238106
- MMP-7 significantly contributes to intestinal epithelial wound closure. IL-1beta increased MMP-7 levels beyond those seen during normal healing. PMID: 20655064
- important role of MMP-2, MMP-9, and TIMP-4 in hypertensive remodeling of the cortex and medulla in the SHR rat PMID: 12923405
- Adrenergic alpha-agonist-induced activation of matrix metalloproteinase-7 promotes vasoconstriction through the epidermal growth factor-receptor pathway. PMID: 14656925
- MMP-7, which was produced by osteoclasts at the tumor-bone interface, was capable of processing RANKL to a soluble form that promoted osteoclast activation. PMID: 15894268
- Diminished expression of MMP-7 may play a role in fibronectin accumulation in the diabetic kidney in response to advanced glycation end products and/or TGF-beta. PMID: 17554258
- Claudin-7, kidney injury molecule-1 (Kim-1), and matrix metalloproteinase-7 (MMP-7) changed by aging and changes attenuated by caloric restriction. PMID: 17670906
- These results suggest a novel role for noncanonical WNT signaling in maintaining kidney transplant tolerance with MMP7 being a key target. PMID: 18209025
- MMP-7 cleaves the NR1 subunit of the N-methyl-d-aspartate (NMDA) receptor to generate an N-terminal fragment of approximately 65 kDa PMID: 18644839
- Agonist signaling of both hypertension and hypertrophy depends on posttranscriptional and transcriptional mechanisms that involve MMP-7, which is transcriptionally connected with ADAM-12 PMID: 19398663