Recombinant Rat Lutropin-Choriogonadotropic Hormone Receptor (LHCGR) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04687P

Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Lutropin-Choriogonadotropic Hormone Receptor (LHCGR) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04687P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Lutropin-Choriogonadotropic Hormone Receptor (LHCGR) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P16235 |
Target Symbol | LHCGR |
Synonyms | LhcgrLutropin-choriogonadotropic hormone receptor; LH/CG-R; Luteinizing hormone receptor; LSH-R |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG |
Expression Range | 27-362aa |
Protein Length | Extracellular Domain |
Mol. Weight | 53.2kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. Secreted. Note=Some isoforms may be secreted. |
Protein Families | G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily |
Database References | KEGG: rno:25477 STRING: 10116.ENSRNOP00000022481 UniGene: PMID: 27940300 |