Recombinant Rat Lutropin-Choriogonadotropic Hormone Receptor (LHCGR) Protein (Flag)

Name: Recombinant Rat Lutropin-Choriogonadotropic Hormone Receptor (LHCGR) Protein (Flag)
Brand: Beta LifeScience
SKU: BLC-09408P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Lutropin-Choriogonadotropic Hormone Receptor (LHCGR) Protein (Flag) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P16235
Target Symbol	LHCGR
Synonyms	LhcgrLutropin-choriogonadotropic hormone receptor; LH/CG-R; Luteinizing hormone receptor; LSH-R
Species	Rattus norvegicus (Rat)
Expression System	Mammalian cell
Tag	C-Flag
Target Protein Sequence	RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG
Expression Range	27-362aa
Protein Length	partial
Mol. Weight	47.8kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Secreted. Note=Some isoforms may be secreted.
Protein Families	G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database References	KEGG: rno:25477 STRING: 10116.ENSRNOP00000022481 UniGene: PMID: 27940300 these results suggest that hCG-induced LHR mRNA downregulation is mediated by cAMP-PKA-ERK1/2 signaling leading to activation of eIF5A hypusination. PMID: 26116232 Demonstrate the presence of LH receptors. Activation resulted in a dose-dependent increase in glucose-induced release of insulin. PMID: 25670721 miR-122 plays a regulatory role in LH/hCG-induced LHR mRNA down-regulation by increasing LRBP expression through the activation of the SREBP pathway. PMID: 26125464 interaction of NF-kappaB p65 with histone deacetylase in the promoter region of Lhcgr might be responsible for TNF-alpha action on the regulation of LH receptor PMID: 26125466 Palmitoylated peptide 562-572 of luteinizing hormone receptor increases testosterone level in male rats. PMID: 25430649 miR-136-3p participated in the down-regulation of LHR mRNA by binding directly to LHR mRNA. PMID: 24025743 IL-6 up-regulates FSH-induced LHR production by increasing mRNA transcription, and JAK/signal transducer and activator of transcription 3 signaling is required for up-regulation by IL-6 in granulosa cells PMID: 24467743 protein kinase A, upon activation in response to FSH signaling to raise intracellular cAMP levels in granulosa cells, phosphorylatesbeta-catenin on 2 C-terminal Serine residues to function as a co-activator for both SF1 and TCF3 on the Lhcgr promoter. PMID: 23754802 These data suggest that the association of LRBP with Luteinizing hormone receptor mRNA results in the translocation of the messenger ribonucleoprotein complex to the p bodies leading to decapping and degradation. PMID: 23376535 These results reveal a novel mechanism of luteinizing hormone receptor regulation by GRP78 in the early stage of corpus luteum formation. PMID: 23175774 that LH acts on the uterus to inhibit contraction at ovulation. PMID: 22367228 Neuropeptide Y activity in the medial preoptic area which affects luteinizing hormone surge may be controlled by locus coerulus neurons. PMID: 16336998 VEGF-A-induced vascularization of the ovary is dictated by the expression of LHR and this might play a regulatory role in ovarian physiology. PMID: 20619315 LHR signaling via PKA activates a cofilin-regulated rearrangement of the actin cytoskeleton and active cofilin is required to initiate progesterone secretion by preovulatory granulosa cells. PMID: 20610540 heterozygous mutation can rescue hormone action PMID: 11859079 Post-transcriptional regulation of luteinizing hormone receptor mRNA in the ovary by a novel mRNA-binding protein (LRBP) PMID: 11940568 the findings demonstrate that Egr-1 actually binds to the regulatory upstream region of the LH receptor gene and positively regulates receptor gene expression PMID: 12021067 A model for constitutive activation is based on molecular simulation and engineered mutations in transmembrane helices 6 and 7 PMID: 12070159 lutropin receptor conformation and molecular model PMID: 12141913 expressed in the adult rat spinal cord PMID: 12505611 Conserved Glu and Asp residues in ligand-mediated signaling buffer dependent in LHR. Identical amino acid residues in homologous receptors can exhibit distinct functions. Role of ionic strength (Na+) on signaling differs in the three receptors. PMID: 12588044 In rat ovaries, MAb found 6 distinct LHR bands migrating at approximately 92, 80, 68, 59, 52 & 48 kDa. There is a possible role for LHR in the development of abnormal pregnancy, pelvic floor disorders & Alzheimer's disease. PMID: 12816543 Chronic elevation of ovarian cAMP leads to a decreased expression of LHR mRNA with a concomitant increase in LHR mRNA binding activity of LHR mRNA binding protein . PMID: 15767047 LHR protein is expressed constitutively in gonadal and nongonadal urogenital tissues as well in adrenal glands, but its final functional maturation at the posttranslational level appears to be developmentally and physiologically regulated. PMID: 15860556 These results show that glycosylation of the LH receptor plays an important role in receptor processing and cell surface expression. PMID: 15866423 luteinizing hormone receptor expression at the cell surface may be controlled at the ER level by regulating the number of newly synthesized proteins that will mature and escape the ER quality control and premature degradation PMID: 15901736 LRBP is a translational inhibitor of LHR mRNA in the ovary PMID: 16263716 The common rat LHR ectodomain splice variant alters the behavior of the full-length receptor by misrouting it away from the normal secretory pathway in human embryonic kidney 293 cells. PMID: 16495341 The data presented here support the model of glycoprotein hormone-receptor interaction in which the hormone binds to the extracellular domain through the beta subunit and then the alpha subunit is brought in contact with the transmembrane domain. PMID: 17045394 These results therefore show that LH receptor mRNA expression in the ovary is regulated post-transcriptionally by altering the rate of mRNA degradation by a specific mRNA binding protein. PMID: 17055149 Results show that metyrapone-induced corticosterone deficiency impairs Leydig cell insulin and prolactin, but not LH, receptors, and their mRNA expression and the response of Leydig cells to LH/PRL/insulin on testosterone production. PMID: 18313837 phosphorylation status of the AKAP MAP2D is acutely regulated by LH receptor-mediated modulation of kinase and phosphatase activities via PKA PMID: 18467524 an intact active site of MVK is required for its binding to rat LHR mRNA and for its translational suppressor function PMID: 18494797 The LHR-stimulated ERK1/2 pathway stimulates epiregulin release. PMID: 18653716 These results suggest that the extracellular domain of the LHR is one of the determinants that confer its ability for proper maturation and cell surface expression. PMID: 18848524 LHCGR mRNA is expressed as a function of the passage of granulosa cells across the G1-S phase boundary PMID: 19293332 during ligand-induced downregulation, LRBP translocates to ribosomes and associates with LHR mRNA to form an untranslatable ribonucleoprotein complex and inhibits LHR mRNA translation, paving the way to its degradation. PMID: 19716387

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Rat Lutropin-Choriogonadotropic Hormone Receptor (LHCGR) Protein (Flag)

Recombinant Rat Lutropin-Choriogonadotropic Hormone Receptor (LHCGR) Protein (Flag)

Product Overview

Target Details

FAQs