Recombinant Rat Inducible T-Cell Costimulator (ICOS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08660P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Inducible T-Cell Costimulator (ICOS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08660P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Inducible T-Cell Costimulator (ICOS) Protein (His) is produced by our E.coli expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9R1T7 |
Target Symbol | ICOS |
Synonyms | Icos; Ailim; Inducible T-cell costimulator; Activation-inducible lymphocyte immunomediatory molecule; CD antigen CD278 |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKLWLP |
Expression Range | 21-145aa |
Protein Length | Extracellular Domain |
Mol. Weight | 18.1kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Strongly expressed in the spleen and lung. Lower expression seen in liver, kidney and testis. |
Gene Functions References
- ICOS-targeted siRNA can effectively silence gene expression of ICOS, and provided satisfactory treatment efficacy for myocardial cell hypertrophy after infarction. PMID: 27323062
- ICOS siRNA can protect brain tissues from ischemia injuries after cerebral infarction, improve limb movement and coordination, lower the mortality rate of rats, and inhibit T cell-induced cytokines PMID: 26436531
- our data highlight a key role for ICOS signaling in the generation of imbalanced production of IL-10 and IL-17 by Treg cells in a rat model of spondyloarthritis. PMID: 24909668