Recombinant Rat Gtpase Hras (HRAS) Protein (His)

Name: Recombinant Rat Gtpase Hras (HRAS) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08267P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Rat Gtpase Hras (HRAS) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P20171
Target Symbol	HRAS
Synonyms	Hras; Hras1; GTPase HRas; H-Ras-1; Transforming protein p21; c-H-ras; p21ras) [Cleaved into: GTPase HRas; N-terminally processed]
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
Expression Range	2-186aa
Protein Length	Full Length of Mature Protein
Mol. Weight	24.9kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
Subcellular Location	Cell membrane. Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Golgi apparatus membrane; Lipid-anchor.
Protein Families	Small GTPase superfamily, Ras family
Database References	KEGG: rno:293621 STRING: 10116.ENSRNOP00000022363 UniGene: Rn.102180

Gene Functions References

Together, these results suggest a novel mechanism regulating PATZ1 expression based on the upregulation of miR-29b expression induced by Ras oncogene. PMID: 27125250
H-ras isoform mediates protection against pressure overload-induced cardiac dysfunction in part through activation of AKT/PI3K signaling pathway. PMID: 28193718
Phenotypic Screening Identifies Protein Synthesis Inhibitors as H-Ras-Nanocluster-Increasing Tumor Growth Inducers. PMID: 26568031
H-Ras mediates the inhibitory effect of epidermal growth factor on the epithelial Na+ channel PMID: 25774517
Data indicate that numerous proteins that are up-regulated in H-ras(G12V) transgenic rat pancreatic ductal adenocarcinoma (PDAC) are also up-regulated in human PDAC; therefore, this rat model can be used for diagnostic biomarkers for this disease. PMID: 23648844
Fe(2+)-generated O(2) mediates p21(ras) and TAK1 activation via PTP inhibition and Lys(63)-polyUb of TRAF6 in caveosomes for proinflammatory M1 activation in hepatic macrophages PMID: 22829592
The proto-oncogenic H-Ras is directly involved in the promotion of muscle differentiation via PI3K and its downstream signaling pathways. PMID: 20603646
Data show that Myc repressed Ras-induced senescence, and that Cdk2 interacted with Myc at promoters, where it affected Myc-dependent regulation of genes, including those of proteins known to control senescence. PMID: 19966300
We examined if H-Ras and K-Ras proteins, which are distributed across different plasma membrane microdomains, have equal access to the endocytic compartment and whether this access is necessary for downstream signaling. PMID: 12077341
A positive regulatory role of Ras is observed in AMPA receptor-mediated synaptic transmission in hippocampal pyramidal neurons. PMID: 12824760
Functional activation of H-Ras might be one of the signaling steps involved in glucose-induced capillary cell apoptosis. PMID: 14988264
Silencing of individual genes by DNA methylation is controlled by HRAS oncogenic signalling pathways, yet the mechanisms responsible for initial target gene suppression are variable. PMID: 16568090
H-ras suppresses integrin affinity via independent Raf and phospholipase C epsilon signaling pathways. PMID: 16895916
analysis of tumor induction with expression plasmids for activated H-ras and c-myc PMID: 18218323
Infection with M. arginini made rat and mouse embryo fibroblasts susceptible to transformation with oncogenic H-Ras PMID: 18408766
induction of long-term potentiation triggered robust Ca2+-dependent Ras activation in single spines that decayed in approximately 5 minutes; Ras activity spread over approximately 10 micrometers of dendrite and invaded neighboring spines by diffusion PMID: 18556515
trend of increased H-ras expression was observed in diabetic compared to normal rats during oncogenesis PMID: 19283661

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.