Recombinant Rat Glutathione S-Transferase P (GSTP1) Protein (His)

Name: Recombinant Rat Glutathione S-Transferase P (GSTP1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03139P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Glutathione S-Transferase P (GSTP1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P04906
Target Symbol	GSTP1
Synonyms	Gstp1; Glutathione S-transferase P; EC 2.5.1.18; Chain 7; GST 7-7; GST class-pi
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ
Expression Range	2-210aa
Protein Length	Full Length of Mature Protein
Mol. Weight	27.3kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Subcellular Location	Cytoplasm. Mitochondrion. Nucleus.
Protein Families	GST superfamily, Pi family
Database References	KEGG: rno:24426 STRING: 10116.ENSRNOP00000024601 UniGene: PMID: 29501922 Data suggest that expression of Gstp1 can be regulated by dietary factors; here, Gstp1 is induced in hepatocytes by carnosic acid, an anticarcinogenic component of rosemary (Rosmarinus officinalis). PMID: 25974399 Data show that Valerian extract inhibits hepatocarcinogenesis by suppressing cell proliferation and inducing apoptosis in glutathione S-transferase pi GST-P(+) foci by activating gamma-aminobutyric acid A receptor GABA(A)RA1-mediated signaling. PMID: 25419570 Cisplatin metabolism in different organs of rats correlated positively with specific GSTP1 activities and this enzyme may be a critical determinant of extent of cellular uptake or retention of cisplatin in renal and liver tissues. PMID: 24474500 GSTP1 application early after myocardial infarction results in long-term beneficial structural and functional effects that prevent progression to heart faiilure. PMID: 24412522 GST-P(-) foci induced by promotion with agonists of peroxisome proliferator-activated receptor-alpha. PMID: 20423715 GSTpi directly associated with signal transducer and activator of transcription 3 (STAT3) to prevent Angiotensin II-triggered binding of Src to STAT3. PMID: 24321768 The change in expression of GST-pi in peripheral blood showed the same pattern as that in brain tissues, suggesting GST-pi might contribute to drug resistance in epilepsy. PMID: 22038365 GST-P-positive lesions may involve a mechanism facilitating lipid peroxidation PMID: 20091025 Exposure to diesel exhaust particles elevated transcription of glutathione-s-transferase gene in rat alveolar macrophages. PMID: 12011483 GSTpi proteins play an important role in the development of acquired drug resistance to various drugs of prostate cancer cells. PMID: 15809768 glutathione S-transferase P1 is induced by proteasome inhibitors PMID: 15863507 Hepaticcgene expression is upregulated by a limited availability of sulfur amino acids PMID: 15867277 GST-Pi expression was induced by the metabolites of cyclophoshamide. PMID: 16242832 Expression of GST-P gene is down-regulated by CCAAT enhancer-binding protein alpha in normal liver. PMID: 16407263 Drug resistant prostate cancer cells displayed significantly increased expression of GSTP1 with other prostate cancer cells. PMID: 16728343 The upregulation of MIF and GSTpi during the development of acquired drug resistance of hormone independent prostate cancer may modulate the activation of gp-170 PMID: 16728344 Expression of GST-P is correlated with cellular proliferation and is associated with risk and progression of oral cancer. PMID: 17596925 These data indicate that expression of GST-P may reflect the carcinogenic effect of cigarette smoke as well as the genetic susceptibility of animals in relation to continuous carcinogens exposure. PMID: 17786572 development of GST-P-negative foci during the early stage of hepatocarcinogenesis PMID: 18081878

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.