Recombinant Rat Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08171P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Rat Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08171P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Rat Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P32301
Target Symbol GLP1R
Synonyms Glp1r; GlprGlucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R
Species Rattus norvegicus (Rat)
Expression System Yeast
Tag N-6His
Target Protein Sequence GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLY
Expression Range 22-145aa
Protein Length Partial
Mol. Weight 16.3 kDa
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 2 family
Database References

KEGG: rno:25051

STRING: 10116.ENSRNOP00000001527

UniGene: PMID: 29412813

  • increased GLP-1R innervation in IBD bowel could mediate enhanced visceral afferent signalling, and provide a peripheral target for therapeutic intervention PMID: 29813107
  • Study found GLP-1/GLP-1R signaling in the brainstem to be required for the central mediation of cancer anorexia-cachexia syndrome in hepatoma tumor-bearing rats. A blockade of brainstem GLP-1 not only attenuated anorexia, but also body weight loss and muscle wasting. PMID: 29247677
  • Results show that lateral dorsal tegmental nucleus (LDTg) GLP-1R signaling is pharmacologically and physiologically relevant for LDTg tointegrate energy balance-relevant signals to modulate feeding and provide novel evidence of gut-nucleus tractus solitarius-LDTg GLP-1 signaling. PMID: 28920591
  • Low GLP-1R expression is associated with intestinal ischemia/reperfusion injury. PMID: 30195035
  • These findings indicate that sitagliptin treatment regulates GLP-1R and CB-1R gene expressions, which are associated with appetite regulation in diabetic rat, and may decrease oxidative stress and liver tissue damage. PMID: 28599244
  • Nucleus tractus solitarius GLP-1R signaling is required for the control of food intake and motivation to feed. PMID: 27782127
  • The findings of this study indicated that increased activation of NTS GLP-1-expressing neurons by corticosterone may represent a homeostatic response to cocaine taking, thereby reducing the reinforcing efficacy of cocaine. PMID: 26675243
  • Exendin-4 treatment decreased MI size, suppressed chamber dilation, myocyte hypertrophy, and fibrosis and improved in vivo heart function in the rats subjected to MI. Exendin-4 resulted in an increase in circulating GLP-1 and GLP-1R in ventricular tissues PMID: 28242257
  • The vasodilatation due to glucagon evokes via the glucagon-receptor, but also via the receptor for GLP-1, and it is endothelium-independent. PMID: 26975347
  • Results suggest that geniposide pretreatment inhibits hypoxia/reoxygenation (H/R)-induced myocardial apoptosis by reversing mitochondrial dysfunction, an effect in part due to activation of GLP-1R and PI3K/AKT signaling pathway. PMID: 27372651
  • Data show that GLP-1 receptor (GLP-1R) activation induced beta-catenin nuclear translocation in bone marrow stromal cells (BMSCs). PMID: 26947974
  • Results strongly implicate the GLP-1R in mediating the unconditioned suppression of dopamine signaling by the emetic agent LiCl and support the GLP-1R as a target in the treatment of maladaptive aversive associations PMID: 26211731
  • hindbrain GLP1 neurons in rats are equipped to store glutamate in synaptic vesicles, and likely co-release both glutamate and GLP1 from axon varicosities and terminals in the hypothalamus and other brain regions PMID: 25012114
  • Glucagon-like peptide-1 receptor (GLP-1R) agonists reduce food intake and are approved by the Food and Drug Administration for the treatment of obesity, but the cellular mechanisms underlying the anorectic effects of GLP-1 require further investigation. PMID: 27013681
  • The favorable preclinical data indicated that (18)F-Al-NOTA-MAL-Cys(39)-exendin-4may be suitable for non-invasive monitoring functional pancreatic beta cells. PMID: 26850848
  • These results suggested that beta-cell GLP-1 receptor signaling involved activation of KATP channels via a PI3K-dependent pathway. PMID: 26655814
  • Vagal afferent neuron knockdown of GLP1R increased meal size, accelerated gastric emptying, increased postprandial glycemia, and blunted insulin release. PMID: 26470787
  • reduced GLP-1R expression in spontaneously hypertensive rat renal arteries most likely mediated through PKCbeta upregulation PMID: 25915883
  • Cardioprotection Resulting from Glucagon-Like Peptide-1 Administration Involves Shifting Metabolic Substrate Utilization to Increase Energy Efficiency in the Rat Heart. PMID: 26098939
  • Activation of the GLP-1 receptors in the nucleus of the solitary tract reduces food reward behavior and targets the mesolimbic system PMID: 25793511
  • these data provide novel evidence that lipotoxicity decreases the mesangial GLP-1R expression in intact cells and in vivo. PMID: 26302449
  • induced T1DM and T2DM may differently modulate GLP-1R system in enteropancreatic axis PMID: 25893200
  • Results illuminate novel neuronal and behavioral mechanisms mediating food intake reduction by GLP-1 via GLP-1R activation in the ventral hippocampal formation PMID: 25035078
  • Hyperglycemia decreases GLP-1R expression in retinal pigment epithelial cells. PMID: 25483438
  • GLP-1 receptors are located in the renal vasculature, including afferent arterioles. Activation of these receptors reduces the autoregulatory response of afferent arterioles to acute pressure increases and increases RBF in normotensive rats. PMID: 25656368
  • GLP-1 receptor agonist increased CTRP3 expression in visceral adipose tissue of type 2 diabetic rats. PMID: 25177707
  • glucose lowering properties of acute administration of GLP-1R agonists are not accounted for by their central effects. PMID: 24879927
  • The results demonstrate GLP-1 receptor regulation of hippocampal function and are consistent with GLP-1 receptor agonists enhancing GABAA signaling by pre- and postsynaptic mechanisms. PMID: 25114295
  • results indicate that GLP-1-producing neurons in the nucleus tractus solitarius project monosynaptically to the lateral parabrachial nucleus, providing a potential endogenous mechanism by which lPBN GLP-1R signaling may exert effects on food intake control PMID: 24681814
  • GLP-1R on POMC/CART-expressing ARC neurons likely mediates liraglutide-induced weight loss PMID: 25202980
  • Food intake inhibitory effects of nucleus tractus solitarius GLP-1R signaling extend beyond satiation and include effects on food reward and motivation that are typically ascribed to midbrain and forebrain neurons. PMID: 24944243
  • Data suggest that signaling involving Glp1/Glp1 receptor in hindbrain neurons (specifically area postrema) is involved in appetite regulation; analogs of GLP1 (agonists of Glp1 receptor) inhibit eating; antagonists of Glp1 receptor stimulate eating. PMID: 24601880
  • Data suggest that responsiveness of pancreatic beta cells to glucose level resulting in secretion of insulin involves Glp1/Glp1r (glucagon-like peptide-1/glucagon-like peptide-1 receptor) signaling and GLP1/Glp1r agonists act as hypoglycemic agents. PMID: 24425760
  • Studied GLP-1R occurrence in normal pancreas, acute pancreatitis (AP)/chronic pancreatitis (CP), and the effects of GLP-1 analog on normal PSCs, their ability to stimulate inflammatory mediator secretion or proliferation. PMID: 24217090
  • Glucagon-like peptide 1 receptor induced suppression of food intake, and body weight is mediated by central IL-1 and IL-6. PMID: 24048027
  • The presence of nutrients in the gut may be required for endogenous stimulation of nucleus accumbens GLP-1R. PMID: 23612998
  • these results indicated that GLP-1 and GLP-1R are implicated in the pathogenesis of irritable bowel syndrome-C and irritable bowel syndrome-D. PMID: 23338623
  • Glp1r activation attenuates high glucose-induced cardiomyocyte apoptosis in association with decreased ER stress and markers of enhanced SERCA2a activity PMID: 23302777
  • GLP-1R expression is strongly up-regulated immediately after birth in neonatal rats, particular in male offspring. PMID: 23354098
  • Pulmonary delivery of ROSE-010 inhibits gut motility through the GLP-1R similar to natural GLP-1. PMID: 22960405
  • The effect of a GLP-1 receptor agonist on single-nephron glomerular filtration rate, proximal reabsorption, tubuloglomerular feedback responses and urine flow rate in hydropenic male Wistar and Wistar-Froemter rats is reported. PMID: 23019232
  • in both mice and rats, peripheral GLP-1 reduces food intake significantly less than Ex-4, even when protected from DPP-4 PMID: 23033273
  • Evolutionarily conserved residues at glucagon-like peptide-1 (GLP-1) receptor core confer ligand-induced receptor activation PMID: 22105074
  • Blockade of endogenous GLP-1R signaling in the VTA and NAc core resulted in a significant increase in food intake, establishing a physiological relevance for GLP-1 signaling in the mesolimbic reward system. PMID: 22128031
  • Glucagon-like peptide-1 receptor activation stimulates hepatic lipid oxidation and restores hepatic signalling alteration induced by a high-fat diet in nonalcoholic steatohepatitis. PMID: 21745271
  • Endogenous GLP-1 receptor signaling is necessary for the reduction in food intake produced by jejunal linoleic acid infusions. PMID: 21917638
  • these findings indicated that glucose fluctuation reduces GLP-1R expression through ER stress more profoundly than sustained hyperglycemia, which may contribute to the diminished response of GLP-1. PMID: 21945929
  • Glucagon-like peptide 1 increases pancreatic insulin secretion by affecting brain stem vagal efferent pathways. PMID: 17322063
  • GLP-1r are present on nerve terminals in hepatic portal bed, and GLP-1 antagonism localized to this region impairs glucose tolerance. These data are consistent with an important component of neural mediation of GLP-1 action. (GLP-1) PMID: 17584962
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed