Recombinant Rat Fibroblast Growth Factor 2 (FGF2), Active

Name: Recombinant Rat Fibroblast Growth Factor 2 (FGF2), Active
Brand: Beta LifeScience
SKU: BLC-05920P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Kinase, Recombinant fibroblast growth factor basic (fgfb/fgf2/bfgf) proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Fibroblast Growth Factor 2 (FGF2), Active is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 0.3-1.8 ng/ml.
Uniprotkb	P13109
Target Symbol	FGF2
Synonyms	Fgf2; Fgf-2Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Expression Range	11-154aa
Protein Length	Partial
Mol. Weight	16.2 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
Subcellular Location	Secreted. Nucleus.
Protein Families	Heparin-binding growth factors family
Database References	KEGG: rno:54250 STRING: 10116.ENSRNOP00000023388 UniGene: PMID: 29895019 FGF2 protects against renal ischemia-reperfusion injury by attenuating mitochondrial damage and proinflammatory signaling. PMID: 28544332 Study shows that fibroblast growth factor 2-ERK1/2 pathway is involved in the pathophysiology of depressive-like behaviors, and manipulating the neurogenesis pathway is a viable therapeutic approach to inflammation-associated depression. PMID: 28529071 These findings may offer insight to help us understand more as to how bFGF ASODN can effectively suppress the proliferation and differentiation of NSCs. PMID: 28390174 the present findings demonstrate that OCT alone or in combination with bFGF accelerates nerve repair in a large peripheral nerve defect in rats. PMID: 27529414 Effect of basic fibroblast growth factor released from chitosan-fucoidan nanoparticles on neurite extension PMID: 23696519 Thus, FGF2 is an alcohol-responsive gene constituting a positive regulatory feedback loop with alcohol. This loop leads to facilitation of alcohol consumption, marking FGF2 as a potential new therapeutic target for alcohol addiction. PMID: 28821667 attempted to identify PKGII-targeted proteins, which are associated with the inhibition of FGF2-induced MAPK activation PMID: 28057484 a moderate level of FGF-2 expression was observed in the cells within the connective tissue of the healing wounds of the normoglycemic group on all days evaluated which differed from that observed in the wounds of the diabetic group PMID: 27188585 overexpression of BNIP3L in H9C2 cardiomyoblast cells reduced the cardioprotection of FGF-2 in hydrogen peroxide-induced necrosis and mitochondrial dysfunction. PMID: 28006775 The induction of active beta-catenin and then fibronectin turnover in response to bFGF were markedly increased in pulmonary fibroblasts from rat with COPD. beta-Catenin/RhoA pathway results in ECM deposition in lung fibroblasts and myofibroblasts differentiation. PMID: 27734223 It plays an important role as a key trigger of Intramuscular adipose tissue formation in vivo. PMID: 26154243 This study demonstrated that altered Cx43 expression modulates bFGF expression, which correlates with prolactinoma development. PMID: 27078698 Basic fibroblast growth factor increased in spinal microglia during the development of allodynia after spinal nerve ligation. PMID: 26583471 TGF-beta1 was upregulated with FGF-2 treatment, and alpha-SMA expression induced by FGF-2 was inhibited after the cell was transferred with TGF-beta1 siRNA. PMID: 26729053 Apocynin attenuated cardiac injury in type 4 radiorenal syndrome rats via inhibiting NADPH oxidase-dependent oxidative stress-activated ERK1/2 pathway and subsequent FGF-2 upregulation. PMID: 26109504 Astrocyte-secreted FGF2 mediated stress-hormone-induced neural stem cell proliferation. PMID: 23599891 Basic fibroblast growth factor and neurotrophin-3, which are released from astrocytes by exposure to thyroid hormone, influence each other to enhance Na+ current density in cultured hippocampal neurons. PMID: 26009773 GK-2 had no effect on the expression level of FGFb and NT4, however, promoted an increase in the expression level of BDNF. PMID: 26571801 FGF-2 in dissociated postnatal retinal cell cultures and found that FGF-2 is a potent factor triggering ganglion cell differentiation PMID: 25402196 Regional differences in the FGF-2 expression pattern as either the first or the second injection of cocaine by themselves upregulated FGF-2 mRNA in the medial prefrontal cortex and nucleus accumbens while downregulating it in the hippocampus. PMID: 25124315 fibroblast growth factor 2has roles in maintenance of the undifferentiated state and in proliferation of Endothelial progenitor cells , allowing EPC to maintain the potential to differentiate to Endothelial Cells. PMID: 24694617 Subsarcolemmal mitochondria are more responsive than interfibrillar mitochondria to FGF-2-triggered protection from calcium-induced permeability transition, by a Cx43 channel-mediated pathway. PMID: 24654232 It was found that cultivation of the cells under hypoxic conditions and bFGF is an optimum to maintain high viability and proliferation capacity of the mesenchymal stem cells. PMID: 25715620 The learning impairment in IL-1beta-treated rats is accompanied by lower FGF-2 mRNA levels in medial prefrontal cortex and ventral (not dorsal) hippocampus, but TIMP-1 was not affected. PMID: 25697011 astroglial cell maturation is enhanced by bFGF through induction of miR-134 PMID: 25482448 bFGF-induced differentiation of dorsal root ganglia stem cells toward Schwann cells might be mediated by binding to fibroblast growth factor receptor-1 (FGFR-1) through activation of MAPK/ERK signal pathway. PMID: 24072480 It is one of the key players in the origin and growth of neuronal and glial cells through autocrine and paracrine signaling. PMID: 24707873 implicate FGF2 as a modifier of epigenetic mechanisms associated with emotional responsiveness, and point to H3K9me3 as a key player in the regulation of affective vulnerability PMID: 25071177 enhanced protein kinase C levels, reduction of basic FGF expression, and increased in apoptosis might be associated with the development of diabetes-induced myoatrophy PMID: 24008114 Studied the change of FGF-2 and IGF-1 in serum and bone callus after fracture in diabetic rats, and explored molecular biological mechanism of healing of diabetic fracture. PMID: 24418087 TGF-beta1 and FGF2 induce the epithelial-mesenchymal transition of Hertwig's epithelial root sheath through a MAPK/ERK-dependent signaling pathway. PMID: 24610459 Following FGF2 treatment, however, bHR-bLR differences in CCK and FGF-R1 mRNA expression were eliminated, due to decreased CCK mRNA levels PMID: 24121132 Retinal injury may enhance neurotrophic factor expression in mesenchymal stem cells and promote the repair process. PMID: 24030359 matrix proteoglycans such as perlecan serve as functional docking platforms for FGF2 in chronic transplant dysfunction. PMID: 24035513 Basic fibroblast growth factor contributes to a shift in the angioregulatory activity of retinal glial (Muller) cells. PMID: 23861940 With an increase in the degree of pressure ulcers, the expression of VEGF and bFGF in pressure ulcers tissue are decreased. This leads to a reduction in angiogenesis and may be a crucial factor in the formation of pressure ulcers. PMID: 23740668 This study provides evidence that E and FGF2 exert a cooperative effect on the lactotroph proliferation principally by signaling initiated at the plasma membrane. PMID: 23651845 Psychological stress could delay periodontitis healing in rats, which may be partly mediated by downregulation of the expression of bFGF in the periodontal ligament. PMID: 23326020 We conclude that FGF-2 secreted by bone marrow-derived cells strongly increases early glial proliferation, which can potentially improve peripheral nervous system regeneration. PMID: 22793996 FGF-2 induced the phosphorylation of Akt and its substrate, glycogen synthase kinase 3beta (GSK3beta) in addition to three MAP kinases in rat glioma cells. PMID: 22575563 Spinal cord treatment of lesion with sciatic nerve and sciatic nerve plus FGF-2 allows recovery of hind limb movements compared to control, manifested by significantly higher behavioral scores after surgery. PMID: 22555431 Inhibitng bFGF alleviates bleomycin-induced pulmonary fibrosis in rats. PMID: 20684286 bFGF promote the proliferation and migration of endothelial progenitor cells, the effects of bFGF being implemented by activating ERK signalling through the expression of Pdgfrb. PMID: 22731705 The epithelial and smooth muscle cell hyperplasia and increased Fgf-2 expression observed in this experimental model of obesity/insulin-resistance might explain the high frequency of benign prostatic hyperplasia in insulin-resistant men. PMID: 22661309 bFGF gene expression is elevated following cerebral concussion, and might play an important role in cell degeneration and necrosis. PMID: 12857442 Data suggest that molecular mechanism of dihydrotestosterone induction of Pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4) during spermatogenesis involves stimulation of Sertoli cells to secrete FGF-2. PMID: 22811469 FGF-2 gene expression is significantly elevated from day 1 to day 14; the increase in FGF-2 protein level is most evident at day 7; cells expressing FGF-2 are primarily endothelial cells following myocardial infarction. PMID: 20674996 The expression of VEGF and bFGF is significantly increased after stromal cell transplantation therapy during the late phase of acute myocardial infarction. PMID: 21162206 astrocyte migration to injury sites may be a key factor in the repair mechanisms orchestrated by FGF2. PMID: 22189091

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.