Recombinant Rat Fad-Linked Sulfhydryl Oxidase Alr (GFER) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-02504P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Rat Fad-Linked Sulfhydryl Oxidase Alr (GFER) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-02504P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Rat Fad-Linked Sulfhydryl Oxidase Alr (GFER) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q63042
Target Symbol GFER
Synonyms Gfer; AlrFAD-linked sulfhydryl oxidase ALR; EC 1.8.3.2; Augmenter of liver regeneration
Species Rattus norvegicus (Rat)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD
Expression Range 1-198aa
Protein Length Full Length
Mol. Weight 38.8kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen. May have a function in liver regeneration and spermatogenesis.
Subcellular Location Mitochondrion intermembrane space. Mitochondrion.
Database References

KEGG: rno:27100

STRING: 10116.ENSRNOP00000017917

UniGene: PMID: 24880092

  • improves hepatocyte survival and promoted liver recovery after transplantation for acute liver failure PMID: 23337881
  • ALR may serve as a potential diagnostic marker of hepatocellular stress and/or acute inflammatory conditions. PMID: 23073658
  • ALR level in serum may indicate hepatocyte proliferation or liver regeneration. High ALR level in serum in early stage of acute-on-chrinic liver failure may mean a good prognosis. PMID: 22246190
  • Loss of augmenter of liver regeneration is associated with renal dysfunction in ischaemia/reperfusion injury. PMID: 20332418
  • effectively accelerates kidney recovery after acute renal failure induced by gentamicin; the protective effect is associated with enhanced proliferation of renal tubular cells PMID: 20030531
  • crystal structure of ALR has been determined to 1.8 A, and possible physiological roles of ALR are examined PMID: 12717032
  • Data show that augmenter of liver regeneration factor (ALR) can promote hepatocyte proliferation induced by Kupffer cells, suggesting that Kupffer cells play a dual role in liver regeneration. PMID: 16937468
  • review of the molecular biology of ALR [review] PMID: 16937489
  • Demonstrate that Alrp improves SH-SY5Y cells survival in H(2)O(2)-induced apoptosis. PMID: 19629817
  • Demonstrate specific G-protein coupled binding of ALR and its function in Kupffer cells and suggest that mediators produced by ALR-stimulated Kupffer cells may elicit physiologically important effects on hepatocytes. PMID: 19859909
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed