Recombinant Rat CXCL5 Protein

Name: Recombinant Rat CXCL5 Protein
Brand: Beta LifeScience
SKU: BLA-2251P
Availability: InStock

Collections: Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Rat
Accession	P97885
Synonym	AMCFII C-X-C motif chemokine 5 C-X-C motif chemokine ligand 5 Chemokine (C X C motif) ligand 5 chemokine (C-X-C motif) ligand 5 Cxcl5 CXCL5_HUMAN ENA 78 ENA-78 (8-78) ENA-78(1-78) ENA-78(9-78) ENA78 Epithelial derived neutrophil activating protein 78 Epithelial-derived neutrophil-activating protein 78 Lipopolysaccharide-induced CXC chemokine Neutrophil activating peptide ENA 78 Neutrophil activating protein 78 Neutrophil-activating peptide ENA-78 neutrophil-activating protein 78 SCYB5 Small inducible cytokine B5 small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78) small inducible cytokine subfamily B, member 5 Small-inducible cytokine B5
Description	Recombinant rat CXCL5 Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKN QKDNVCLDPQAPLIKKVIQKILGSENKKTKRNALALVRSASTQ
Molecular Weight	10 kDa
Purity	>97% SDS-PAGE.Purification is by SDS-PAGE and HPLC.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using Human peripheral blood neutrophils is less than 100 ng/ml, corresponding to a specific activity of > 1.0 x 104 IU/mg.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

Target Details

Target Function	May participate in the recruitment of inflammatory cells by injured or infected tissue.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	KEGG: rno:60665 STRING: 10116.ENSRNOP00000003823 UniGene: Rn.44449

Gene Functions References

CRH suppressed CXCL5 production in glia via CRHR1 in the hippocampus of male rats. PMID: 29126185
up-regulation of spinal CXCL5 and CXCR2 is involved in neuropathic pain after nerve injury, through regulating GSK-3beta activity in rats. PMID: 27717828
Analysis of mitogen-activated protein kinases (MAPK) and glycogen synthase kinase (GSK3) pathways showed that they are involved in mechanisms of neuronal apoptosis in response to the depletion of CXCL5/LIX signaling. PMID: 22034072
Data demonstrate that the chemokine CXCL5 is a peripheral mediator of UVB-induced inflammatory pain, likely in humans as well as rats. PMID: 21734176
Disrupted expression of CXCL5 in colorectal cancer is associated with rapid tumor formation in rats and poor prognosis in patients. PMID: 18413816

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.