Recombinant Rat CXCL2 Protein

Name: Recombinant Rat CXCL2 Protein
Brand: Beta LifeScience
SKU: BLA-2250P
Availability: InStock

Collections: Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Rat
Accession	P30348
Synonym	C-X-C motif chemokine 2 Chemokine (C X C motif) ligand 2 Chemokine, CXC motif, ligand 2 CINC 2a CINC2a CINC3 CXC chemokine CXCL 2 Cxcl2 CXCL2_HUMAN Cytokine-induced neutrophil chemoattractant 3 GRO 2 GRO b GRO protein, beta Gro-beta GRO-beta(5-73) GRO-beta-T GRO2 GRO2 oncogene GROb GRObeta Growth regulated protein beta Growth-regulated protein beta GROX Hematopoietic synergistic factor HSF Macrophage inflammatory protein 2 Macrophage inflammatory protein 2 alpha Macrophage inflammatory protein 2-alpha Melanoma growth stimulatory activity beta MGSA b MGSA beta MIP 2 MIP 2a MIP2 MIP2 alpha MIP2-alpha MIP2A MIP2alpha SB-251353 Scyb SCYB 2 SCYB2 Small inducible cytokine subfamily B, member 2
Description	Recombinant rat CXCL2 Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN
Molecular Weight	8 kDa
Purity	>98% SDS-PAGE.> 98 % by HPLC analysis.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Fully biologically active when compared to standard.The biological activity determined by a chemotaxis bioassay using Rat neutrophils is in a concentration range of 10-100 ng/mL.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

Target Details

Target Function	Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. Contributes to neutrophil activation during inflammation.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	KEGG: rno:114105 STRING: 10116.ENSRNOP00000003745 UniGene: Rn.10230
Tissue Specificity	At least expressed in the lung and trachea.

Gene Functions References

this study shows elevated expression of CINC-3 at the site of inflammation as well as their significant reflection in the circulation, thereby suggesting their frontline role in carrageenan-induced acute inflammation PMID: 27967265
rutin is a potential protective agent in spinal cord injury enhancing the neurotrophic effect by inhibiting the expression of MIP-2 and activation of MMP-9, and downregulating the expression of p-Akt. PMID: 26502930
The rat spiral ligament fibrocytes were found to release CXCL2 in response to nontypeable H. influenzae via activation of c-Jun, leading to the recruitment of polymorphonuclear cells to the cochlea. PMID: 22379036
CsA has no significant effect on serum levels of MCP-1 and MIP-2 following renal transplantation in rats. PMID: 20034917
Results identify FQHPSFI peptide may be used for the modulation of lipopolysaccharide-stimulated MIP-2 production in alveolar macrophagess. PMID: 20186460
chemokine production by rat alveolar macrophages is inhibited by taurine chloramine PMID: 11716962
Intratracheal LPS induced a significant increase in MIP-2 in bronchoalveolar lavage (BAL) fluid with no detectable MIP-2 in the plasma. PMID: 11837784
demonstrated that the beta-glucan component of the Pneumocystis carinii cell wall is able to stimulate alveolar epithelial cells to produce MIP-2 PMID: 11906040
role for the nitric oxide pathway in the overproduction of pro-inflammatory mediators IL-6 and MIP-2 during GBS-induced lung inflammation. PMID: 12661899
junctional epithelium cells produced MIP-2 and CINC-2 in response to LPS stimulation, suggesting that MIP-2 and CINC-2 may be responsible for PMN migration toward the periodontal pathogen and may play an important role in the initiation of inflammation PMID: 15045510
macrophage inflammatory protein 2 mediates platelet-activating factor-induced intestinal injury PMID: 15319184
no significant differences were detected for MIP-2 levels in diabetic rats when compared with non-diabetic rats after hypoxia PMID: 16132691
Following cecal ligation and puncture Cxcl2 production increases in the lung, setting the stage for neutrophil accumulation in lung during sepsis. PMID: 16818791
MIP-2/CXCL2 and MCP-1/CCL2 are increased after injury, and neurons appear to be the source of this expression. Chemokine expression was selectively inhibited by dexamethasone. PMID: 19210118

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.