Recombinant Rat Complement C3 (C3) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10535P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Rat Complement C3 (C3) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10535P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Rat Complement C3 (C3) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P01026
Target Symbol C3
Synonyms C3Complement C3 [Cleaved into: Complement C3 beta chain; C3-beta-c; C3bc; Neutrophil chemotactic factor-2; ENCF-2); Complement C3 alpha chain; C3a anaphylatoxin; Neutrophil chemotactic factor-1; ENCF-1); Acylation stimulating protein; ASP; C3adesArg); Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment; Complement C3f fragment; Complement C3c alpha' chain fragment 2]
Species Rattus norvegicus (Rat)
Expression System Yeast
Tag N-6His
Target Protein Sequence SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL
Expression Range 671-746aa
Protein Length Partial
Mol. Weight 11.0kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. In chronic inflammation, acts as a chemoattractant for neutrophils.; Acts as a chemoattractant for neutrophils in chronic inflammation.; adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.
Subcellular Location Secreted.
Database References

KEGG: rno:24232

STRING: 10116.ENSRNOP00000066885

UniGene: PMID: 28582497

  • Inhibition of C3 might improve the reactivity of superior mesenteric arteries to norepinephrine during hemorrhagic shock possibly through the downregulation of NO, ET1, TNF-alpha and reactive oxygen radicals. PMID: 26687560
  • Recruited microglia/monocytes contribute to activation of complement in the aging retina, through local expression of C3 mRNA. PMID: 24705166
  • The C3 and C3a receptor system may primarily be involved in the pathogenesis of renal remodeling in hypertensive rats. PMID: 23713944
  • The expression of the complement component C3f and the complement component 4A have potential for use in post-transplant diagnosis of rejection. PMID: 23613499
  • Abnormal activation of complement C3 in the spinal dorsal horn is closely associated with progression of neuropathic pain. PMID: 23588254
  • The retinal irradiation with 670-nm light substantially reduces the propagation of complement3 in the retina following light-induced degeneration. PMID: 23181358
  • Early response to blast injury involves activation of complement and TNFalpha, correlating with hippocampus and cerebral cortex immune-inflammatory damage. PMID: 22537900
  • Carboxypeptidase B2 and complement C3 were more abundant in the cerebrospinal fluid of experimental autoimmune encephalomyelitis rats that did not respond to minocyline treatment. PMID: 22768796
  • Increase of C3 expression occurs in light damaged retina leading to retinal degeneration. PMID: 22183312
  • C3 and C4 may be involved in the immunopathology of allergic rhinitis. PMID: 17345707
  • Perivascular adipose tissue-derived C3 stimulated adventitial fibroblast migration and differentiation via the c-Jun N-terminal kinase pathway and may contribute to adventitial remodeling in a deoxycorticosterone acetate-salt hypertensive model. PMID: 20864665
  • downregulation in microglia while differentiating into ramified cells PMID: 12137932
  • complement C3 expression is regulated by the bile acid receptor FXR PMID: 15590640
  • Increased STAT-1, IRF-1 and complement component C3 in several models of liver transplant tolerance suggests that the STAT-1/IRF-1 apoptotic pathway and C3 may be involved in the tolerogenic mechanism. PMID: 16555329
  • Complement C1 Inactivator Proteins, in addition to inhibition of the systemic complement activation, prevents myocardial cell injury via a direct inhibitory role in the local myocardial C3 activity PMID: 16996480
  • C3a and C5a mediate distinct effects on blood pressure and circulating polymorphonuclear leukocytes in the rat. PMID: 19285573
  • role for C3 in influencing the level of expression of CR3 by modulating the transcript levels encoding the CD11b alpha integrin protein PMID: 19710459
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed