Recombinant Rat Comm Domain-Containing Protein 5 (COMMD5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05155P
Greater than 85% as determined by SDS-PAGE.
Recombinant Rat Comm Domain-Containing Protein 5 (COMMD5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05155P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Comm Domain-Containing Protein 5 (COMMD5) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9ERR2 |
| Target Symbol | COMMD5 |
| Synonyms | Commd5; COMM domain-containing protein 5; Hypertension-related calcium-regulated gene protein; HCaRG |
| Species | Rattus norvegicus (Rat) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD |
| Expression Range | 2-224aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 31.8 kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis. Down-regulates activation of NF-kappa-B. |
| Subcellular Location | Nucleus. |
| Database References | KEGG: rno:245974 STRING: 10116.ENSRNOP00000065036 UniGene: PMID: 11871861 |
