Recombinant Rat Cellular Tumor Antigen P53 (TP53) Protein (His)

Name: Recombinant Rat Cellular Tumor Antigen P53 (TP53) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02323P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Cellular Tumor Antigen P53 (TP53) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P10361
Target Symbol	TP53
Synonyms	Tp53; P53; Cellular tumor antigen p53; Tumor suppressor p53
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
Expression Range	1-391aa
Protein Length	Full Length
Mol. Weight	47.5kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Its pro-apoptotic activity is activated via its interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2. However, this activity is inhibited when the interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 is displaced by PPP1R13L/iASPP. In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seems to have an effect on cell-cycle regulation. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2.
Subcellular Location	Cytoplasm. Nucleus. Nucleus, PML body. Endoplasmic reticulum. Mitochondrion matrix. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Protein Families	P53 family
Database References	KEGG: rno:24842 STRING: 10116.ENSRNOP00000047840 UniGene: PMID: 28131915 these findings indicated that miR31a5p is involved in hypertension via the accelerated proliferation of arterial smooth muscle cells and inhibition of apoptosis through targeting TP53. PMID: 29620173 Study revealed initial downregulation in the expression of p53 protein during breast cancer development. However, with progression towards malignancy, upregulation of p53 was observed. These changes were associated with polymorphism in p53 gene, which was detected in exon 5. PMID: 29498408 Compared with the saline Hepatocellular carcinoma (HCC)-group, transplantation with CD34+ human hematopoietic stem cells produced a further increase in the levels of wnt4 (+19.4%) and p53 gene expression (+53%), a 2-fold increase in the percentage of cancer progenitor cells and increased HCC pathology grading PMID: 29429512 The results indicate that the miR-188-3p-MDM2-p53 axis may have a critical role in sevoflurane-induced cognitive dysfunction. PMID: 29344658 MiR-31a-5p protects cardiomyocytes against angiotensin II-induced apoptosis by targeting Tp53. PMID: 29286111 Results suggest that Delta40p53 can be generated by a 20S proteasome-mediated post-translational mechanism so as to control p53 function. PMID: 28885617 The results suggested that caveolin1 may be involved in nucleus pulposus cellular senescence during oxidative stress in vitro, mainly via the p53/p21 signaling pathway. PMID: 29039595 our results revealed that the upregulation of p53 and possibly other anti-oncogenes may provide a potential effective therapeutic strategy for malignant pheochromocytoma PMID: 29048679 over-expression of p53 could mediate oligodendrocyte apoptosis thus resulting in demyelination in two ways; by enhancing ER-mitochondria interaction and by triggering the E2F1 mediated apoptosis pathway. PMID: 28237798 Effect of polydatin on expression of p53 and Notch1 in brain tissue of ischemic cerebrovascular disease. PMID: 29504377 pharmacological inhibition of ATM kinase (KU55933) reduced activation of ATM kinase, but not p53, suggesting that HG-mediated activation of p53 and ATM could represent independent pro-apoptotic events..these data indicate that sustained activation of Rac1-p38MAPK signaling axis leads to activation of p53 leading to beta-cell dysfunction under the duress of chronic hyperglycemic conditions PMID: 28220272 JNK/p53 pathway might play a critical role in the tubular cell apoptosis induced by -MCPD 1-palmitate. PMID: 27008853 the Ras/Raf/Erk signals contribute to neuronal death through the phosphorylation of p53 in hippocampus after subarachnoid hemorrhage. PMID: 26497030 Hypoxia and hyperoxia differentially control proliferation of rat neural crest stem cells via distinct regulatory pathways of the HIF1alpha-CXCR4 and TP53-TPM1 proteins PMID: 28002632 This study determined if dietary restriction (DR) protects against hypoxic-ischemia (HI) in the neonatal brain via insulin receptor substrate-1 (IRS-1)/Akt pathway-mediated downregulation of p53 in the neurovascular unit. PMID: 26111627 Results suggest that the cancer-inhibitory activity of sodium butyrate and its derivatives on liver carcinogenesis may be attributed to retention of p53 and CRM1 proteins in the nucleus, an event that may trigger activation of p53-mediated apoptotic cell death in neoplastic cells. PMID: 27013579 The Fischer model is more consistent with the early onset of bone and central nervous system sarcomas found in humans with germline Tp53 mutations. PMID: 27528400 findings reveal a novel function of p53 in controlling inflammatory responses and suggest that p53 abnormalities in rheumatoid arthritis could sustain and accelerate synovial inflammation PMID: 27881147 mammalian SOS response is characterized by an increase in the p53 gene with activation of multiple DNA repair genes that harbor p53 response elements in their promoters. PMID: 28800961 Doxorubicin (Dox)-administration to cardiomyocytes increased the levels of reactive oxygen species (ROS) in a time-dependent manner that followed the activation of stress-induced proteins p53, p38 and JNK MAPKs, culminating in an increase in autophagy and apoptosis markers. PMID: 28678856 ANXA1 interacts with p53 and promotes p53 transcriptional activity, which in turn regulates Bid expression. PMID: 27584794 transformed MSCs express high levels of a p53 mutant that loses the ability to bind survivin gene PMID: 27046449 an Ntv-a transgenic rat colony was established and used to study glial brain tumors driven by two well-characterized oncogenic gene transformations, PDGFA overexpression and p53 depletion. Combined PDGFA and p53 alterations resulted in large, heterogeneous tumors in all affected animals PMID: 28358926 MEG3 could interacted with p53 and regulated its expression, and p53 exerted significant binding in the promoters for NOX4, suggesting that MEG3 regulated NOX4 expression via p53. PMID: 28634073 The miR-34a/SIRT1/p53 signaling pathway is activated in hepatocytes but not hepatic stellate cells during liver fibrosis PMID: 27387128 MDM2 is involved in fibroblast activation, mediating renal tubulointerstitial fibrosis via a p53-independent pathway dependant on Notch1 ubiquitination and proteasome degradation. PMID: 28100501 These data indicates that Drp1 mediates compression-induced programmed necrosis of NP cells by promoting mitochondrial translocation of p53 and nuclear translocation of AIF. PMID: 28411026 Formononetin prevents cisplatin-induced acute kidney injury by targeting Oct2/TP53 in the kidney. PMID: 28414026 Alloxan-induced renal damage is associated with alterations of p53, TGF-beta1, and extracellular matrix metalloproteinases. PMID: 28220578 Taken together, these results indicated that ALA protected dopaminergic neurons against MPP+induced neurotoxicity through its ability to upregulate the DNA repair protein, PCNA, via the P53 pathway. PMID: 27665784 SIRT1 attenuates cerebral ischemia/reperfusion-induced injury by targeting the p53/microRNA-22 axis. PMID: 27878231 Cholesterol regulates bone marrow mesenchymal stem cell senescence by modulating cell cycle, autophagy, and the ROS/p53/p21(Cip1/Waf1) signaling pathway. PMID: 27703600 results suggest that dysregulation of miR-30c and miR-181a may be involved in upregulation of p53-p21 pathway in diabetes induced cardiac hypertrophy. PMID: 27221738 miR-449 regulates the SIRT1/p53/BAX pathway, which may be its possible mechanism in modulating cell apoptosis of cisplatin-induced Acute kidney injury. PMID: 26968221 In conclusion, Cabin1 expression significantly increases during podocyte injury. Knockdown of Cabin1 induces p53 expression decrease in cultured podocyte. Cabin1 may provide a new target to investigate podocyte injury. PMID: 26400065 p53 regulates autophagic activity in senescent rat mesenchymal stromal cells. PMID: 26792455 This indicates that MPP+-induced oxidative damage is mediated by the downregulation of PCNA through the p53 pathway in a cellular model of Parkinson's disease . PMID: 26677001 The results of the present study therefore indicated that resveratrol protected H9c2 cells from DOX-induced apoptosis via the AMPK/P53 pathway PMID: 26675978 Hypoxia response element Bcl2 inhibition can effectively attenuate hypoxia-induced apoptosis resistance in pulmonary microvascular endothelial cells by downregulating Bcl2 expression and upregulating caspase-3 and P53 expression. PMID: 26456506 Study suggested that neonatal bronchopulmonary dysplasia caused impaired cognitive function and neuron apoptosis in hippocampus via p53 and HIF-1alpha PMID: 26431790 miR-23a binds to p53 and enhances its association with miR-128 promoter PMID: 26553132 Hydrogen-rich saline is able to protect against AKI after liver transplantation partly by reducing apoptosis, which is possibly involved in the modulation of p53-mediated autophagy. PMID: 26714124 These results suggest the existence of a causal link between Cox-2 and p53, which may represent a toxic mechanism of electrophilic lipid peroxidation products. PMID: 25506925 Autoimmune Optic Neuritis Is Associated with Altered APP Cleavage in Neurons and Up-Regulation of p53 PMID: 26426258 findings show p53 is activated in astrocytes during ischemia and that inhibition of the activity of this molecule prevents not only oxygen-glucose deprivation-induced neuronal and astrocytic death but also astrocyte activation and impaired glutamate uptake PMID: 26302161 CHIP stabilizes amyloid precursor protein via proteasomal degradation and p53-mediated trans-repression of BACE1. PMID: 25773675 Phosphorylation of p53 by LRRK2 induces p21(WAF1/CIP1) expression and apoptosis. PMID: 26384650 Diabetes upregulates p21(CIP1/Waf1) signaling in testicular germ cells in association with alteration in p-p53ser315 expression, probably to counteract DNA damage-induced cell death. PMID: 24828139 Our results also suggest that chromothripsis primarily occurs under p53 heterozygous rather than p53 null conditions. PMID: 25811670

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.