Recombinant Rat Cathepsin K (CTSK) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03135P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Cathepsin K (CTSK) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03135P
Collections: Enzymes, Featured enzyme molecules, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Cathepsin K (CTSK) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O35186 |
Target Symbol | CTSK |
Synonyms | Ctsk; Cathepsin K; EC 3.4.22.38 |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARNKNNACGITNLASFPKM |
Expression Range | 115-329aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 27.5kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Thiol protease involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Involved in the release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen. |
Subcellular Location | Lysosome. Secreted. Apical cell membrane; Peripheral membrane protein; Extracellular side. |
Protein Families | Peptidase C1 family |
Database References |
Gene Functions References
- the present study identified icariin as a novel therapeutic agent in DXM-induced cartilage injury in rats, and revealed that the activation of miR-206 targeting of cathepsin K may be responsible for the chondroprotective efficacy of icariin PMID: 29207029
- cathepsin K, in both its secreted and lysosomal forms, may play a role in the degradation of Sertoli cell residual bodies PMID: 14585819
- In conclusion, according to its ability to modulate hypotensive effects of kinins, we propose that cathepsin K is a kininase of biological relevance. PMID: 17181996
- Comparison of the S2 site between rat and human cathepsin K sequences indicated that two S2 residues at Ser134 and Val160 in rat are varied to Ala and Leu, respectively, in the human enzyme. PMID: 18664521
- The expression pattern of Ctsk in osteoclasts in physiological root resorption in the rat molar was determined. PMID: 18974601