Recombinant Rat Carboxypeptidase A1 (CPA1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02816P
Greater than 85% as determined by SDS-PAGE.
Recombinant Rat Carboxypeptidase A1 (CPA1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02816P
Collections: Enzymes, Featured enzyme molecules, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Carboxypeptidase A1 (CPA1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P00731 |
Target Symbol | CPA1 |
Synonyms | Cpa1; CpaCarboxypeptidase A1; EC 3.4.17.1 |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY |
Expression Range | 111-419aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 39.6 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. Catalyzes the conversion of leukotriene C4 to leukotriene F4 via the hydrolysis of an amide bond. |
Subcellular Location | Secreted. |
Protein Families | Peptidase M14 family |
Database References |
Gene Functions References
- gene transcripts for CPA1 in mesentery and other extrapancreatic tissues indicate that CPA1 might play a role in the renin-angiotensin system in addition to it'sfunction as digestive enzyme PMID: 22178042
- Data show that latexin protein expression was reduced after SNI, and the decrease of latexin was associated with an increase of the activity of carboxypeptidase A. PMID: 21572518
- carboxypeptidase A, dipeptidase and Na+/K+ ATPase levels in the rat intestine change when exposed to different doses of cadmium PMID: 15865404