Recombinant Rat Carbonic Anhydrase 2 (CA2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07281P

Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Carbonic Anhydrase 2 (CA2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07281P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Carbonic Anhydrase 2 (CA2) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P27139 |
Target Symbol | CA2 |
Species | Rattus norvegicus (Rat) |
Expression System | Yeast |
Tag | C-6His |
Target Protein Sequence | SHHWGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVASKSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELMVDNWRPAQPLKNRKIKASFK |
Expression Range | 2-260aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 30.5 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Essential for bone resorption and osteoclast differentiation. Reversible hydration of carbon dioxide. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6. |
Subcellular Location | Cytoplasm. Cell membrane. |
Protein Families | Alpha-carbonic anhydrase family |
Database References |
Gene Functions References
- Myocardial carbonic anhydrase 1/2 activation is significantly elevated in diabetic ischemic cardiomyopathy. PMID: 24670789
- Our results demonstrate a selective CA facilitation of acid/base transporters in the ventricular myocyte, implying a specific role for the intracellular enzyme in HCO3- transport, and hence pHi regulation in the heart. PMID: 24297849
- CAII/NHE1 interaction constitutes a component of the slow force response to heart muscle stretch, which potentiates NHE1-mediated H(+) transport in the myocardium. PMID: 23709596
- Report CAIImRNA expression was significantly decreased in ovariectomized rats exposed to pulsed electromagnetic fields. PMID: 21327437
- why CAH II is cytoplasmic resident in some organs and secreted in others PMID: 14644548
- Immunohistochemical co-expression of carbonic anhydrase II with Kv1.4 and TRPV1 in rat small-diameter trigeminal ganglion neurons PMID: 15885224
- Immunohistochemical localization of proteins known to be important in HCO(3) (-) secretion was investigated in the rat common bile duct. PMID: 16575514
- The results indicate that there is a relationship between the fluid shear stress and the mRNA expression of CAII in polarized rat osteoclasts PMID: 16777439
- CAII is expressed in rat alveolar epithelial cells and does not regulate lung alveolar fluid reabsorption during hypercapnia. PMID: 17690328