Recombinant Rat Brevican Core Protein (BCAN) Protein (His&Myc)

Name: Recombinant Rat Brevican Core Protein (BCAN) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01369P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Brevican Core Protein (BCAN) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P55068
Target Symbol	BCAN
Synonyms	Brain-enriched hyaluronan-binding protein Short name: BEHAB
Species	Rattus norvegicus (Rat)
Expression System	Baculovirus
Tag	N-10His&C-Myc
Target Protein Sequence	DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM
Expression Range	658-786aa
Protein Length	Partial
Mol. Weight	19 kDa
Research Area	Cell-Matrix Adhesion
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor.
Subcellular Location	[Isoform 1]: Secreted, extracellular space, extracellular matrix.; [Isoform 2]: Membrane; Lipid-anchor, GPI-anchor.
Protein Families	Aggrecan/versican proteoglycan family
Database References	KEGG: rno:25393 STRING: 10116.ENSRNOP00000025496 UniGene: PMID: 25052349 during excitotoxic neurodegeneration the observed ADAMTS-induced cleavage of brevican in the dentate outer molecular layer is closely associated with diminished synaptic density PMID: 12379262 The expression pattern and cell associations of inhibitory brevican have important implications for axon regeneration across acute and chronic spinal cord scar tissue. PMID: 12526031 B/b130 glycovariant of BEHAB/brevican is up-regulated during rat brain development and in a rat model of invasive glioma PMID: 12799382 In a rodent model of neonatal hypoxia-ischemia, a marked decline is found in the expression of brevican, whose expression is correlated with oligodendrocyte survival, growth, and maturation. PMID: 15817274 TGFbeta may play a role in neuronal plasticity through its regulation of brevican and the activity of the ADAMTSs. PMID: 15935069 Brevican is primarily synthesized by co-cultured GFAP-positive astrocytes and co-assembles with its interaction partners in perineuronal net-like structures on neuronal somata & neurites; axon initial segments are strongly covered by a dense brevican coat PMID: 16503162 Brevican deposition is elevated in response to progressive gray matter injury, whereas diminished versican expression may be associated with deep cerebral white matter injury. PMID: 17972319

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.