Recombinant Rat Basic Leucine Zipper Transcriptional Factor Atf-Like 3 (BATF3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10912P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Basic Leucine Zipper Transcriptional Factor Atf-Like 3 (BATF3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10912P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Basic Leucine Zipper Transcriptional Factor Atf-Like 3 (BATF3) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P97876 |
| Target Symbol | BATF3 |
| Synonyms | Batf3; Jdp1Basic leucine zipper transcriptional factor ATF-like 3; B-ATF-3; Jun dimerization protein 1; JDP-1 |
| Species | Rattus norvegicus (Rat) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV |
| Expression Range | 1-133aa |
| Protein Length | Full Length |
| Mol. Weight | 19.1kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens. |
| Subcellular Location | Nucleus. |
| Protein Families | BZIP family |
| Database References | |
| Tissue Specificity | Ubiquitously expressed. |
