Recombinant Rat Apoptosis Regulator Bcl-2 (BCL2) Protein (His)

Name: Recombinant Rat Apoptosis Regulator Bcl-2 (BCL2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02055P
Price: 2546.4 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Apoptosis Regulator Bcl-2 (BCL2) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P49950
Target Symbol	BCL2
Species	Rattus norvegicus (Rat)
Expression System	in vitro E.coli expression system
Tag	N-10His
Target Protein Sequence	MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Expression Range	1-236aa
Protein Length	Full Length
Mol. Weight	28.1 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.
Subcellular Location	Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families	Bcl-2 family
Database References	KEGG: rno:24224 STRING: 10116.ENSRNOP00000003768 UniGene: Rn.9996
Tissue Specificity	Expressed in a variety of tissues, with highest levels in reproductive tissues. In the adult brain, expression is localized in mitral cells of the olfactory bulb, granule and pyramidal neurons of hippocampus, pontine nuclei, cerebellar granule neurons, an

Gene Functions References

The findings suggest that experimental hyperthermia (EH) exposure leads to simultaneous activation of molecular switches of apoptosis (BCL2 and BAD) in cells of the follicular epithelium of the ovaries on days 3 and 4 after EH. PMID: 29658076
miRNA-15b deteriorates cardiomyocyte apoptosis by post-transcriptionally downregulating the expression of Bcl-2 and MAPK3. PMID: 28814571
Melatonin, but not curcumin, significantly increased the Bcl-2 expression of the hippocampal region. There was a significant correlation between SIRT2 and MDA levels. Results suggest that melatonin may increase cell survival in the hippocampus via decreasing oxidative stress and SIRT2 expression and increasing Bcl-2 expression. PMID: 29325994
The expression of Bax and Bcl-2 after ligation of the parotid gland is closely related to the process of the parotid gland atrophy. PMID: 29243771
Data suggest that neuroprotection via ghrelin involves up-regulation of Bcl-2 (B cell lymphoma 2 associated oncogene) and p-62/Sqstm1 (ubiquitin-binding protein p62) plus down-regulation of LC3-II (microtubule-associated protein 1 light chain 3) and Beclin-1. Studies were conducted in adult hippocampal neural stem cells in primary culture. PMID: 29057768
Treatment of ellagic acid resulted in increased neuron viability, cell nuclear integrity, and the ratio of Bcl-2/Bax expression in the primary cultured neuron model. PMID: 28388366
High expression of prosurvival BCL2 proteins and inhibition of apoptosis and autophagy prolongs Sertoli survival upon exposure to stress stimuli. PMID: 28379541
Changes in p53 and Bcl-2 expression are spatially correlated to degenerated hair cells in aging rat cochleae. PMID: 28093932
miR-486 may regulate cardiomyocyte apoptosis via p53-mediated BCL-2 associated mitochondrial apoptotic pathway. PMID: 28486954
These data validated that SRF responded to hypoxia, which subsequently was involved in pulmonary hypertension by abnormally promoting viability of PASMCs via modulating expression of Bcl-2. PMID: 28176371
upon CHIP knockdown, the expression of Bax and caspase-3 mRNAs increased even further, and the expression of Bcl-2 mRNA was further suppressed. The expression of the phosphorylated p65 and p38 proteins (p-p65 and p-p38) was also further enhanced. Thus, CHIP is a potent cardioprotective molecule. PMID: 28257878
These findings indicated for the first time that pretreatment of H9c2 cells with catalpol can be against H2O2-induced apoptosis, and the protective effect of catalpol involves the mitochondrial-dependent caspase pathway and is associated with increased Bcl-2 and decreased Bax expression. PMID: 27166426
Acute ethanol exposure induced autophagy-mediated heart toxicity and injury mainly through the ROS-JNK-Bcl-2 signaling pathway. PMID: 28369910
Bcl2 protein content of skeletal muscle was increased after 8 weeks of treadmill running in aging rats. PMID: 27526155
Sphallerocarpus gracilis polysaccharide protected pancreatic beta-cells from alloxan damage by several possible mechanisms, including: (1) repairing free radical damage; (2) reducing the apoptosis of pancreatic beta-cells by inhibiting the activities of caspase-3 and bax, and enhancing the activity of bcl-2; (3) stimulating insulin secretion and upregulating the pancreatic and duodenal homeobox 1 gene PMID: 27645924
Data suggest that microRNA miR-98 might promote chondrocyte apoptosis and cartilage degradation by down-regulating Bcl-2 expression in the pathogenesis of osteoarthritis (OA), and that miR-98 can be a potential target for the treatment of OA. PMID: 27590063
Morin-5'-sulfonic acid sodium salt prevents changes in the expression of apoptosis related proteins caspase 3, Bax and Bcl 2 due to mercury induced oxidative stress. PMID: 27919736
Chrysin prevents apoptosis by upregulating the Bcl-2 mRNA expression and downregulating the pro-apoptotic (Bax, Bad) mRNAs in 3-nitropropionic acid induced behavioral despair/mitochondrial dysfunction/striatal apoptosis. PMID: 27690136
Morinda citrifolia augmented the expression of Bcl2 in the skeletal muscle of intra-nigrally rotenone-infused Parkinsonian rats PMID: 26697948
Hypoxia response element Bcl2 inhibition can effectively attenuate hypoxia-induced apoptosis resistance in pulmonary microvascular endothelial cells by downregulating Bcl-2 expression and upregulating caspase-3 and P53 expression. PMID: 26456506
VPA protects myocardial cells from hemorrhagic and hypoxic stress through the Akt/BCL-2 survival pathway, indicating a potential use of HDACIs for acute severe hemorrhage treatment. PMID: 26886004
TP53, BCL-2, and VEGFA genes may participate in the proliferation of esophagus cancer cells in a synergistic manner PMID: 26439224
The spinal cord may be protected from spinal cord ischemia reperfusion injury by inhibition of BAX and activation of BCL2. PMID: 26400280
Intermittent hypobaric hypoxia preconditioning activated the expression of neuroglobin and Bcl-2 in the rat hippocampal CA1 area following ischemia-reperfusion, and prevented hippocampal neuronal apoptosis. PMID: 26400308
Pre-ischemic exercise prevented apoptosis in hippocampal CA3 neurons after cerebral ischemia by attenuating Bax/Bcl-2 protein ratio. PMID: 26012958
MicroRNA34a induces apoptosis in PC12 cells by reducing expression of BCL2 and SIRT1. PMID: 26252661
ISO increased NOXs-derived ROS which activated nuclear translocation of calpain-2, subsequently nuclear calpain-2 degraded CaMK II dB which reduced the ratio of Bcl-2 to Bax and mitochondria apoptosis pathway was triggered in rat cardiomyocytes PMID: 25820554
The present study aimed to study the changes in P53, Bcl-2 and CD68 expression in response to amethopterin-induced lung injury and ameliorating the role of l-carnitine. PMID: 24986327
Compared with the control group, the model and treatment groups showed significantly upregulated caspase-3, Bcl-2, and Bax mRNA and protein levels in brain tissues, but remarkably downregulated Bcl-2 mRNA and protein levels PMID: 26125843
Bcl-2 expression is increased during neuronal differentiation of neural stem cells. PMID: 24986006
Findings indicate that Bcl-2 phosphorylation and thereby Bcl-2/Beclin1 complex disruption play a crucial role in triggering autophagy and reducing mitochondrial damage in RIC rats after cerebral ischemia and require the involvement of the AKT activation. PMID: 25744447
ROS/Bcl-2/Bax and the ROS/microcirculation/ starving pathway control the effect of scutellarin on type II diabetes mellitus-induced testicular damages PMID: 25861655
Enhanced splicing of XBP-1 was observed in BCL-2 overexpressing cells implicating BCL-2 in the complex regulation of IRE1alpha activity. PMID: 26319553
DSW drinking reduced ulcer area as well as apoptotic signaling in acetic acid-induced duodenal ulcers. DSW, which contains selenium, provides intestinal protection against duodenal ulcers through the upregulation of Bcl-2 and thioredoxin reductase PMID: 24984066
Hydrogen-rich saline ameliorated inflammatory infiltration and decreased cell apoptosis;tissues with a high expression of Bcl-2 and a low expression of pASK-1, pJNK, and Bax, a larger survival area and a high level of blood perfusion. PMID: 26003800
Bcl-xL and Bcl-2, in a PI3K-dependent manner, which is upstream of NF-kappaB activation. PMID: 25220584
The level of Bax mRNA and protein increased, while the content of Bcl2 mRNA and protein decreased 30 min after tetanization of the CA1 field of rat hippocampal slices. PMID: 25403402
It has been found that NaBut reduces proliferation rate of ERasBcl (E1A, cHa-ras and bcl-2 ) cells significantly weaker than of ERas transformed cells PMID: 26035971
up-regulated SSTR1 contributed to neuronal apoptosis after intracerebral hemorrhage, which was accompanied with reduced expression of bcl-2. PMID: 25035058
oxymatrine can attenuate the development of UC by regulating the DOR-beta-arrestin1-Bcl-2 signal transduction pathway. PMID: 25480575
the effects of mobile phones on the Bcl-2 gene and p53 proteins in rat brains PMID: 24763879
Overexpression of Bcl-2 in the transplanted NESCs enhanced differentiation. PMID: 23324128
Which might result in the disassociation of Bcl-2 from the Bad/Bcl-2 complex. PMID: 24957688
Studied the effect of acute renal ischemia reperfusion on brain tissue and results showed decreased Bcl-2 expression and upregulated expression of NF-kappaB. PMID: 25063066
Treatment with 6-OHDA reduced PC12 Bcl-2 mRNA levels by about fourfold. CDNF pretreatment attenuated this. PMID: 24633814
Hepatocyte apoptosis could promote NAFLD progression; Fas, FasL, and Caspase-8 mRNA activation were important contributing factors to NAFLD. The upregulation of Bax and Bcl-2 expression might be one important mechanism of the apoptosis in NAFLD. PMID: 24938610
results indicated that after TBI in rats CXCL12 combing CXCR4 receptors could inhibit the caspase-3 pathway by upregulating Bcl-2:Bax ratio, which protect neurons from apoptosis PMID: 23984821
These results suggest the involvement of Bcl-2 and BDNF in processes of adaptation to SH and compensation of its damaging effects. PMID: 25282819
Suggest that miR-21 promotes the development of heart failure with preserved left ventricular ejection fraction by up-regulating the expression of anti-apoptotic gene Bcl-2 and thereby promoting cardiac fibrosis. PMID: 24551276
A critical role of NF-kappaB-mediated miR-30b modulation in Ang II-stimulated cardiomyocytes targeting Bcl-2. PMID: 24178239

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.