Recombinant Rat Apolipoprotein C-I (APOC1) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-09096P
Greater than 85% as determined by SDS-PAGE.
Recombinant Rat Apolipoprotein C-I (APOC1) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-09096P
Collections: Cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Apolipoprotein C-I (APOC1) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P19939 |
Target Symbol | APOC1 |
Synonyms | Apoc1Apolipoprotein C-I; Apo-CI; ApoC-I; Apolipoprotein C1; Liver regeneration-related protein LRRG04) [Cleaved into: Truncated apolipoprotein C-I] |
Species | Rattus norvegicus (Rat) |
Expression System | Mammalian cell |
Tag | C-hFc |
Target Protein Sequence | APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA |
Expression Range | 27-88aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 34.7 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. |
Subcellular Location | Secreted. |
Protein Families | Apolipoprotein C1 family |
Database References |