Recombinant Rat Angiopoietin-2 (ANGPT2) Protein (His)

Name: Recombinant Rat Angiopoietin-2 (ANGPT2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00969P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Rat Angiopoietin-2 (ANGPT2) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O35462
Target Symbol	ANGPT2
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	YNNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHSVQLQSMKEQKDQLQVLVSKQSSVIDELEKKLVTATVNNSVLQKQQHDLMETVNSLLTMMSSPDYKSSVAVPKEEKTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEVKAYCDMDMGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTSGHRYVLKIQLKDWEGSEAHSLYEHFYLSGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLTGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Expression Range	19-496aa
Protein Length	Full Length of Mature Protein
Mol. Weight	58.6 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
Subcellular Location	Secreted.
Database References	KEGG: rno:89805 STRING: 10116.ENSRNOP00000022774 UniGene: Rn.138360

Gene Functions References

Based on these findings, we propose that Cx43 was the Cx isoform involved in MEGJ-mediated VEC-dependent regulation of Ang-2, which induces iNOS protein expression and vascular hyporeactivity after hypoxia. PMID: 28637680
H2S may play a protective role in infrarenal aortic clamping induced acute lung injury in rats by inhibiting inflammation and Ang2 release. PMID: 26781077
Inhibition of angiopoietin-2 is an effective and safe treatment for liver fibrosis in CCl4 -treated rats, acting mainly through the induction of vessel normalization and the attenuation of hepatic inflammatory infiltrate. PMID: 24612347
responsible for the vascular hyporeactivity at late hemorrhagic shock through the Tie2-Erk-iNOS pathway PMID: 22869617
it is unlikely that induction of Ang-2 contributes to vascular dysfunction underlying functional impairment after spinal cord injury, but rather that it contributes to the beneficial pro-angiogenic and/or gliogenic processes PMID: 22020092
Decreased angiopoietin1/Tie2 and increased angiopoietin2 expression may contribute to diabetes-induced vascular damage after stroke. PMID: 21515377
Hyperoxia induced neovascularization and inhibited the expression of ang-2 in the retina. PMID: 19573435
The expression of Ang-2 protein in serum was significantly positively correlated with the extent lung injury. PMID: 19900368
Expression of angiopoietin-2 increased after stroke in all rat strains and was significantly enhanced in SHR stroke-prone compared with control strains PMID: 11822892
These data suggest that Ang2 might modulate both angiogenesis and vascular regression in the rat brain and that capillary regression occurring during deadaptation involves activation of apoptosis. PMID: 12183511
Expressed in rat brain during hypoxia and de-adaptation. PMID: 12580449
we demonstrate that testicular vascular endothelial growth factor-A (VEGF-A), ang 1, ang 2, and the ang-receptor tie 2 are expressed in the testis PMID: 12773423
Angiopoietin2 and Tie2, but not angiopoietin1 mRNA were increased with retinopathy of prematurity. PMID: 12937129
Angiopoietin-1 but not angiopoietin-2 has a role in experimental glioma angiogenesis PMID: 15509526
Following injury, Ang2 may play a role in BBB breakdown of perilesional vessels, and it may also be a factor in endothelial cell apoptosis that occurs at days 1 and 2 following the injury. PMID: 16056241
Data demonstrate that vascular smooth muscle cells adjust angiopoietin-2 expression through multiple mechanisms, including changes in transcription as well as posttranscriptional mRNA destabilization. PMID: 16176970
Up-regulation of Ang-2, a proangiogenic factor, and the down-regulation of PEDF, an antiangiogenic factor, is indicative of an imbalance between pro- and antiangiogenic factors in the hypoxic retina that may favor neovascularization. PMID: 17943991
glomerular expression of ANG-1 and ANG-2 is differentially regulated and may contribute to healing and endothelial cell stabilization in experimental glomerulonephritis PMID: 18272601
Abnormal expression and reciprocal egulation of Angpt2 may play important roles in the development of chronic allograft nephropathy in rat renal allografts. PMID: 18929864
Ang2-derived tumor vessels lead to an inadequate oxygenation of the tumor tissue, leading to impairment in tumor growth PMID: 19168695

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.