Recombinant Rat Amphoterin-Induced Protein 3 (AMIGO3) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-09395P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Amphoterin-Induced Protein 3 (AMIGO3) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-09395P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Amphoterin-Induced Protein 3 (AMIGO3) Protein (His-Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q80ZD5 |
| Target Symbol | AMIGO3 |
| Synonyms | Amigo3; Ali3Amphoterin-induced protein 3; AMIGO-3; Alivin-3 |
| Species | Rattus norvegicus (Rat) |
| Expression System | Mammalian cell |
| Tag | N-6His-Myc |
| Target Protein Sequence | TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCSVAAAPGLELPEEELHTHVGQSLRLFCNTTVPAARVAWVSPKNELLVAPGSQDGSIAVLADGSLAIGRVQEQHAGLFVCLASGPRLHHNQTLEYNVSVHKPRPEPEAFNT |
| Expression Range | 20-383aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 44.4kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Immunoglobulin superfamily, AMIGO family |
| Database References | KEGG: rno:316003 UniGene: Rn.203829 |
