Recombinant Rat Allograft Inflammatory Factor 1 (AIF1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09703P

Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Allograft Inflammatory Factor 1 (AIF1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09703P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Allograft Inflammatory Factor 1 (AIF1) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P55009 |
Target Symbol | AIF1 |
Synonyms | Aif1; Iba1; Mrf1Allograft inflammatory factor 1; AIF-1; Ionized calcium-binding adapter molecule 1; MRF-1; Microglia response factor |
Species | Rattus norvegicus (Rat) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP |
Expression Range | 2-147aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 18.7kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. |
Subcellular Location | Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, phagocytic cup. |
Database References | |
Tissue Specificity | Cardiac allograft, spleen and testis. Expressed by inflammatory cells (macrophages and neutrophils). |
Gene Functions References
- lumbar disc herniation upregulates microglial Iba1 activity and CGRP expression in many adjacent and ipsilateral lumbar spinal segments PMID: 26713069
- The responses suggest that depending on the type of lesion DRG Iba-1 (+) resident macrophages have different activation mechanisms, which are dissimilar to those in microglia. PMID: 23701965
- AIF-1 was activated in warm and cold ischemia-reperfusion injury, and pretreatment with low-dose FK506 partly inhibited AIF-1 activation and reduced warm and cold IR injury. PMID: 19815232
- Iba-1 protein was detected only in microglial cells, macrophages of brain meninges, supraependymal macrophages, superficial and stromal cells of the choroid plexus--all the cells possessing phagocytotic function. PMID: 20572385
- In a transient middle cerebral artery occlusion model of rats, a large ischemic lesion is formed where macrophage-like cells massively accumulate, many of which express a macrophage marker, Iba1 PMID: 19861972
- High levels of AIF-1 expression reflect aggressive liver allograft rejection and suggest a role for monitoring AIF-1 in peripheral blood leukocytes. PMID: 15575896
- There is a functional interaction between AIF-1 and Rac2 in VSMC leading to Rac2 activation and a potential function for Rac2 in inflammation-driven VSMC response to injury. PMID: 16987989
- AIF-1 is a novel molecular component of podocytes and the upregulation of AIF-1 in an anti-GBM nephritis model may mainly be a consequence of its expression in infiltrating cells. PMID: 17035944
- Accumulation of macrophage-like cells expressing NG2 proteoglycan and Iba1 in ischemic core of rat brain after transient middle cerebral artery occlusion PMID: 17565360
- AIF-1 expression plays a key role in the development of neointimal hyperplasia. AIF-1 expression enhances the activation of p38 MAP kinase. AIF-1-enhanced proliferation is p38 kinase dependent, but AIF-1-enhanced VSMC migration is p38 independent. PMID: 18779232