Recombinant Rat Aldehyde Dehydrogenase, Mitochondrial (ALDH2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06846P
Recombinant Rat Aldehyde Dehydrogenase, Mitochondrial (ALDH2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06846P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Aldehyde Dehydrogenase, Mitochondrial (ALDH2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P11884 |
Target Symbol | ALDH2 |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | SAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS |
Expression Range | 20-519aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 57.0 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Subcellular Location | Mitochondrion matrix. |
Protein Families | Aldehyde dehydrogenase family |
Database References |
Gene Functions References
- ALDH2 inhibition protects against hepatic ischemia-reperfusion injury in rats via alleviation of oxidative stress. PMID: 29589772
- findings suggested that ALDH2 is expressed in neonate rat cardiac fibroblasts; activation of ALDH2 decreases the HG-induced apoptosis and fibrosis through inhibition of oxidative stress. PMID: 29129988
- ALDH2 O-GlcNAc modification is associated with hyperglycemic exacerbation during myocardial ischemia/reperfusion injury. PMID: 28038474
- Chronic hyperglycemia reduces ALDH2 activity, leading to mitochondrial respiratory dysfunction and consequently cardiac damage and dysfunction. PMID: 27736868
- Mitochondrial aldehyde dehydrogenase activation by alda-1 led to a significant attenuation of depressive- and anxiety-like behaviors in the prenatally stressed rats. PMID: 26254233
- High concentrations of ethanol aggravate cerebral injury by inhibiting of aldehyde dehydrogenase 2 and inducing excess accumulation of aldehydes PMID: 26172086
- The administration of the ALDH2-coding vector to the ventral tegmental area leading to an increased ability to degrade acetaldehyde greatly reduces chronic alcohol consumption and post-deprivation binge drinking for prolonged periods. PMID: 24571199
- Aberrant hypermethylation of CpG sites in ALDH2 promoter upstream sequence is associated with myocardial ischemia injury. PMID: 25629048
- ALDH2 is inhibition of MPTP opening and iNOS expression in cardiac function in response to treatment with Alda1, a specific activator of ALDH2. PMID: 25351957
- ALDH2 may be at least in part involved in nitrite-mediated hypotensive effects and nitrite catalysis in many organs of normoxic rats. PMID: 24164360
- Selective activation of mitochondrial aldehyde dehydrogenase 2 is sufficient to improve the heart failure outcome PMID: 24817685
- the mitochondrial enzyme ALDH2 regulates nociception PMID: 25163478
- Ethanol was used induce ALDH2 activity, which decreased myocardial injury in diabetic rats. PMID: 23500772
- In diabetic rats, enhanced ALDH2 expression can offer mycardial protection possibly by suppressing cell apoptosis. PMID: 22445980
- In diabetic rats, the expression of ALDH2 was decreased when the heart was subjected to ischemia/reperfusion. PMID: 22737913
- ALDH2 activation substantially reduces hypoxia-induced norepinephrine release during myocardial ischemia. PMID: 22761303
- The protective role of ALDH2 against ER stress-induced cell death was probably mediated by Akt via a p47(phox) NADPH oxidase-dependent manner. These findings indicate the critical role of ALDH2 in the pathogenesis of ER stress in heart disease. PMID: 22430940
- Changes in the GSH and GSH enzymatic system, and in the ADH3 and ALDH2 retinal expression and distribution might be crucial in assessing the intrinsic mechanisms of LPO-mediated retinopathies. PMID: 22117533
- study provides evidence that the simultaneous increase of liver ADH and a reduction of ALDH activity by gene transfer could constitute a potential therapeutic strategy for the treatment of alcoholism. PMID: 22214999
- our results suggested that ALDH2 might play a vital role in protecting antimycin A-induced oxidative stress and apoptosis in cardiomyocytes PMID: 21123025
- A decrease was observed in both ALDH2 protein expression (80% in tolerant veins and 30% in tolerant arteries after 48 h exposure to GTN) and aortic ALDH activity. PMID: 21506955
- Overexpressed ALDH2 gene may moderate 4-hydroxynonenal-induced neuronal death by regulating caspase-3 protein and reactive oxygen species level in cultured hippocampal neurons. PMID: 20361289
- the effects of Mg(2+) on the ALDH2-NADH binding characteristics and enzyme catalysis PMID: 21276780
- Data suggest that ALDH2 inhibition may be associated with LV reduced contractility, and mitochondrial impairment aggravated by ALDH2 inhibition might reflect an underlying mechanism which causes cardiac dysfunction in diabetic rats. PMID: 20957334
- Ethanol postconditioning upregulated mitochondrial ALDH2 mRNA expression in isolated rat heart. PMID: 21166048
- this finding raises the possibility that ALDH2 as the transcriptional regulator might function as a direct sensor of the cellular metabolic state for regulating gene expression at general transcription level. PMID: 21130747
- Inhibition of this enzyme is effective in suppressing cocaine-seeking behavior, and may beo of therapeutic value for treating human cocaine addiction and preventing relapse. PMID: 20729865
- ALDH2 plays an important role in the bioactivation of glyceryl trinitrate and nitrite in the pulmonary and systemic vascular beds PMID: 20543077
- The line difference in AcH aversion is associated more with brain ALDH2 activity than with liver ALDH2 activity. PMID: 14690875
- mtALDH overexpression attenuates hyperoxia-induced cell death in lung epithelial cells through reduction of reactive oxygen species, activation of ERK/MAPK, and PI3K-Akt cell survival signaling pathways PMID: 16782756
- lipoic acid has a role in the redox regulation of mitochondrial aldehyde dehydrogenase (ALDH-2) activity PMID: 17102135
- Increased superoxide production in nitrate tolerance is associated with Nox1 and Aldh2 down-regulation. PMID: 17493633
- mitochondrial aldehyde dehydrogenase 2 (ALDH2)was identified as an enzyme whose activation correlates with reduced ischemic heart damage in rodent models PMID: 18787169