Recombinant Rat Aldehyde Dehydrogenase, Mitochondrial (ALDH2) Protein (His)

Name: Recombinant Rat Aldehyde Dehydrogenase, Mitochondrial (ALDH2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-06846P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Aldehyde Dehydrogenase, Mitochondrial (ALDH2) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P11884
Target Symbol	ALDH2
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	SAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Expression Range	20-519aa
Protein Length	Full Length of Mature Protein
Mol. Weight	57.0 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Mitochondrion matrix.
Protein Families	Aldehyde dehydrogenase family
Database References	KEGG: rno:29539 STRING: 10116.ENSRNOP00000001816 UniGene: Rn.101781

Gene Functions References

ALDH2 inhibition protects against hepatic ischemia-reperfusion injury in rats via alleviation of oxidative stress. PMID: 29589772
findings suggested that ALDH2 is expressed in neonate rat cardiac fibroblasts; activation of ALDH2 decreases the HG-induced apoptosis and fibrosis through inhibition of oxidative stress. PMID: 29129988
ALDH2 O-GlcNAc modification is associated with hyperglycemic exacerbation during myocardial ischemia/reperfusion injury. PMID: 28038474
Chronic hyperglycemia reduces ALDH2 activity, leading to mitochondrial respiratory dysfunction and consequently cardiac damage and dysfunction. PMID: 27736868
Mitochondrial aldehyde dehydrogenase activation by alda-1 led to a significant attenuation of depressive- and anxiety-like behaviors in the prenatally stressed rats. PMID: 26254233
High concentrations of ethanol aggravate cerebral injury by inhibiting of aldehyde dehydrogenase 2 and inducing excess accumulation of aldehydes PMID: 26172086
The administration of the ALDH2-coding vector to the ventral tegmental area leading to an increased ability to degrade acetaldehyde greatly reduces chronic alcohol consumption and post-deprivation binge drinking for prolonged periods. PMID: 24571199
Aberrant hypermethylation of CpG sites in ALDH2 promoter upstream sequence is associated with myocardial ischemia injury. PMID: 25629048
ALDH2 is inhibition of MPTP opening and iNOS expression in cardiac function in response to treatment with Alda1, a specific activator of ALDH2. PMID: 25351957
ALDH2 may be at least in part involved in nitrite-mediated hypotensive effects and nitrite catalysis in many organs of normoxic rats. PMID: 24164360
Selective activation of mitochondrial aldehyde dehydrogenase 2 is sufficient to improve the heart failure outcome PMID: 24817685
the mitochondrial enzyme ALDH2 regulates nociception PMID: 25163478
Ethanol was used induce ALDH2 activity, which decreased myocardial injury in diabetic rats. PMID: 23500772
In diabetic rats, enhanced ALDH2 expression can offer mycardial protection possibly by suppressing cell apoptosis. PMID: 22445980
In diabetic rats, the expression of ALDH2 was decreased when the heart was subjected to ischemia/reperfusion. PMID: 22737913
ALDH2 activation substantially reduces hypoxia-induced norepinephrine release during myocardial ischemia. PMID: 22761303
The protective role of ALDH2 against ER stress-induced cell death was probably mediated by Akt via a p47(phox) NADPH oxidase-dependent manner. These findings indicate the critical role of ALDH2 in the pathogenesis of ER stress in heart disease. PMID: 22430940
Changes in the GSH and GSH enzymatic system, and in the ADH3 and ALDH2 retinal expression and distribution might be crucial in assessing the intrinsic mechanisms of LPO-mediated retinopathies. PMID: 22117533
study provides evidence that the simultaneous increase of liver ADH and a reduction of ALDH activity by gene transfer could constitute a potential therapeutic strategy for the treatment of alcoholism. PMID: 22214999
our results suggested that ALDH2 might play a vital role in protecting antimycin A-induced oxidative stress and apoptosis in cardiomyocytes PMID: 21123025
A decrease was observed in both ALDH2 protein expression (80% in tolerant veins and 30% in tolerant arteries after 48 h exposure to GTN) and aortic ALDH activity. PMID: 21506955
Overexpressed ALDH2 gene may moderate 4-hydroxynonenal-induced neuronal death by regulating caspase-3 protein and reactive oxygen species level in cultured hippocampal neurons. PMID: 20361289
the effects of Mg(2+) on the ALDH2-NADH binding characteristics and enzyme catalysis PMID: 21276780
Data suggest that ALDH2 inhibition may be associated with LV reduced contractility, and mitochondrial impairment aggravated by ALDH2 inhibition might reflect an underlying mechanism which causes cardiac dysfunction in diabetic rats. PMID: 20957334
Ethanol postconditioning upregulated mitochondrial ALDH2 mRNA expression in isolated rat heart. PMID: 21166048
this finding raises the possibility that ALDH2 as the transcriptional regulator might function as a direct sensor of the cellular metabolic state for regulating gene expression at general transcription level. PMID: 21130747
Inhibition of this enzyme is effective in suppressing cocaine-seeking behavior, and may beo of therapeutic value for treating human cocaine addiction and preventing relapse. PMID: 20729865
ALDH2 plays an important role in the bioactivation of glyceryl trinitrate and nitrite in the pulmonary and systemic vascular beds PMID: 20543077
The line difference in AcH aversion is associated more with brain ALDH2 activity than with liver ALDH2 activity. PMID: 14690875
mtALDH overexpression attenuates hyperoxia-induced cell death in lung epithelial cells through reduction of reactive oxygen species, activation of ERK/MAPK, and PI3K-Akt cell survival signaling pathways PMID: 16782756
lipoic acid has a role in the redox regulation of mitochondrial aldehyde dehydrogenase (ALDH-2) activity PMID: 17102135
Increased superoxide production in nitrate tolerance is associated with Nox1 and Aldh2 down-regulation. PMID: 17493633
mitochondrial aldehyde dehydrogenase 2 (ALDH2)was identified as an enzyme whose activation correlates with reduced ischemic heart damage in rodent models PMID: 18787169

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.