Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04483P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04483P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Vegfa protein: target overview, research applications, and selection guide
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rabbit Vascular Endothelial Growth Factor A (VEGFA) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | XP_002714743.1 |
| Target Symbol | VEGFA |
| Species | Oryctolagus cuniculus (Rabbit) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR |
| Expression Range | 51-511aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 65.7kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
