Recombinant Pseudomonas Phage Phi6 Rna-Directed Rna Polymerase (P2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01745P
Greater than 85% as determined by SDS-PAGE.
Recombinant Pseudomonas Phage Phi6 Rna-Directed Rna Polymerase (P2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01745P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Pseudomonas Phage Phi6 Rna-Directed Rna Polymerase (P2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P11124 |
| Target Symbol | P2 |
| Synonyms | Protein P2 |
| Species | Pseudomonas phage phi6 (Bacteriophage phi-6) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | NKEEKVKEWSLCVATDVSDHDTFWPGWLRDLICDELLNMGYAPWWVKLFETSLKLPVYVGAPAPEQGHTLLGDPSNPDLEVGLSSGQGATDLMGTLLMSITYLVMQLDHTAPHLNSRIKDMPSACRFLDSYWQGHEEIRQISKSDDAILGWTKGRALVGGHRLFEMLKEGKVNPSP |
| Expression Range | 310-485aa |
| Protein Length | Partial |
| Mol. Weight | 27.2 kDa |
| Research Area | Transcription |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Rna-dependent RNA polymerase part of the packaging complex that packages the viral RNA segments, replicate them into a double-stranded form and transcribe them. |
| Subcellular Location | Virion. Note=Found in the capsid (12 copies). Prior to RNA packaging, localizes on the inner procapsid surface near the three-fold axis of symmetry. |
| Database References | KEGG: vg:956436 |
Gene Functions References
- Purified polymerase P2 is able to transcribe dsRNA, but transcription behavior of bacteriophage Phi6 RNA segment L by both wild-type and mutant polymerases is different from that seen in capsid structures. PMID: 23864621
- The structurally flexible hinge region appeared to be involved in the control of priming platform movement. PMID: 22770923
- Divalent cations modulate the structural dynamics of phi6 RNA-dependent RNA polymerase. PMID: 22205747
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
