Recombinant Pseudomonas Aeruginosa Protein Hcp1 (HCP1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00452P
Greater than 90% as determined by SDS-PAGE.
Recombinant Pseudomonas Aeruginosa Protein Hcp1 (HCP1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00452P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Pseudomonas Aeruginosa Protein Hcp1 (HCP1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9I747 |
| Target Symbol | HCP1 |
| Species | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA |
| Expression Range | 1-162aa |
| Protein Length | Full Length |
| Mol. Weight | 24.9 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Required for assembly of the protein secretion apparatus HSI-I. Actively secreted during chronic infection of cystic fibrosis patients. |
| Subcellular Location | Secreted. |
| Protein Families | Hcp1 family |
| Database References | KEGG: pae:PA0085 STRING: 208964.PA0085 |
Gene Functions References
- Hcp1 protein is an exported receptor and chaperone of type VI bacterial secretion substrates.Hcp1 is a chaperone required for the intracellular accumulation of Tse2. PMID: 23954347
- Hcp1 secretion requires either VgrG1a or VgrG1c, which may act independently to puncture the bacterial envelope and give Hcp1 access to the surface. PMID: 21325275
- current data indicating that the HSI-I locus actively secretes Hcp1 during chronic infection of CF patients, collectively suggest a role for HSI-I in chronic P. aeruginosa infections PMID: 16763151
