Recombinant Pseudomonas Aeruginosa Pa-I Galactophilic Lectin (LECA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04268P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lecA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lecA.
Recombinant Pseudomonas Aeruginosa Pa-I Galactophilic Lectin (LECA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04268P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Pseudomonas Aeruginosa Pa-I Galactophilic Lectin (LECA) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q05097 |
| Target Symbol | LECA |
| Synonyms | lecA; pa1L; PA2570; PA-I galactophilic lectin; PA-IL; Galactose-binding lectin |
| Species | Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| Expression Range | 2-122aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 16.8kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hemagglutinating activity. |
| Subcellular Location | Cytoplasm. Periplasm. Cell surface. Note=Low exposure on the cell surface. |
| Protein Families | LecA/PllA lectin family |
| Database References | KEGG: pae:PA2570 STRING: 208964.PA2570 |
Gene Functions References
- The crystal structure of LecA/melibiose complex shows a secondary sugar binding site with glucose bound. PMID: 24123124
- Study established the structural features of PA-IL (LecA} in complex with the three disaccharides by docking and molecular dynamics simulations. PMID: 20410292
- It is concluded that the carbohydrate recognizing site of the lectin can have a binding requirement of only one saccharide. PMID: 16542817
- Results describe the crystal structure of P. aeruginosa lectin I complexed to alphaGal1-3betaGal1-4Glc trisaccharide at 1.9-A resolution and reveal how the second galactose residue makes specific contacts with the protein surface. PMID: 18762193
- The results demonstrate that there is a relationship between the LecA and LecB lectins and the pathogenicity of P. aeruginosa. PMID: 19237519
