Recombinant Pseudomonas Aeruginosa Exotoxin A Regulatory Protein (TOXR) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-05028P
Greater than 85% as determined by SDS-PAGE.
Recombinant Pseudomonas Aeruginosa Exotoxin A Regulatory Protein (TOXR) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-05028P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Pseudomonas Aeruginosa Exotoxin A Regulatory Protein (TOXR) Protein (His-KSI) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P09852 |
| Target Symbol | TOXR |
| Synonyms | toxR; regA; PA0707; Exotoxin A regulatory protein |
| Species | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Expression System | E.coli |
| Tag | N-6His-KSI |
| Target Protein Sequence | MTATDRTPPPLKWLCLGNRDANDGFELFAHGIYARNGALVGSKLSLRERRQRVDLSAFLSGAPPLLAEAAVKHLLARLLCVHRHNTDLELLGKNFIPLHASSLGNAGVCERILASARQLQQHQVELCLLLAIDEQEPASAEYLTSLARLRDSGVRIALHPQRIDTDARQCFAEVDAGLCDYLGLDARLLAPGPLTRNLRQRKSIEYLNRLLVAQDIQMLCLNVDNEELHQQANALPFAFRHGRHYSEPFQAWPFSSPAC |
| Expression Range | 1-259aa |
| Protein Length | Full Length |
| Mol. Weight | 44.2 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Positive regulation of toxA gene transcription. |
| Subcellular Location | Cell inner membrane; Peripheral membrane protein. |
| Database References | KEGG: pae:PA0707 STRING: 208964.PA0707 |
