Recombinant Porphyromonas Gingivalis Gingipain R2 (RGPB) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04146P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Porphyromonas gingivalis (strain ATCC BAA-308 / W83) rgpB.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Porphyromonas gingivalis (strain ATCC BAA-308 / W83) rgpB.
Recombinant Porphyromonas Gingivalis Gingipain R2 (RGPB) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04146P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Porphyromonas Gingivalis Gingipain R2 (RGPB) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P95493 |
| Target Symbol | RGPB |
| Synonyms | rgpB; prtRII; rgp2; PG_0506Gingipain R2; EC 3.4.22.37; Arg-gingipain; Gingipain 2; RGP-2 |
| Species | Porphyromonas gingivalis (strain ATCC BAA-308 / W83) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC |
| Expression Range | 230-473aa |
| Protein Length | Partial |
| Mol. Weight | 43.3kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Thiol protease. Acts synergistically with RgpA to catalyze the maturation of fimbrial subunits, such as FimA. Its proteolytic activity is a major factor in both periodontal tissue destruction and in evasion of host defense mechanisms. |
| Subcellular Location | Secreted. |
| Protein Families | Peptidase C25 family |
| Database References | KEGG: pgi:PG_0506 STRING: 242619.PG0506 |
