Recombinant Porcine Parvovirus Capsid Protein Vp1 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-09036P
Greater than 85% as determined by SDS-PAGE.
Recombinant Porcine Parvovirus Capsid Protein Vp1 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-09036P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Porcine Parvovirus Capsid Protein Vp1 Protein (His&Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P18546 |
| Target Symbol | P18546 |
| Synonyms | Capsid protein VP1; Coat protein VP1 |
| Species | Porcine parvovirus (strain NADL-2) (PPV) |
| Expression System | Mammalian cell |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MAPPAKRARGLTLPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYDKYIKSGKNPYFYFSAADEKFIKETEHAKDYGGKIGHYFFRAKRAFAPKLSETDSPTTSQQPEVRRSPRKHPGSKPPGKRPAPRHIFINLAKKKAKGTSNTNSNSMSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGE |
| Expression Range | 1-207aa |
| Protein Length | Partial |
| Mol. Weight | 26.4 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Capsid protein self-assembles to form an icosahedral capsid with a T=1 symmetry, about 22 nm in diameter, and consisting of 60 copies of two size variants of the capsid proteins, VP1 and VP2, which differ by the presence of an N-terminal extension in the minor protein VP1. The capsid encapsulates the genomic ssDNA. Capsid proteins are responsible for the attachment to host cell receptors. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Binding to the host receptors also induces capsid rearrangements leading to surface exposure of VP1 N-terminus, specifically its phospholipase A2-like region and putative nuclear localization signal(s). VP1 N-terminus might serve as a lipolytic enzyme to breach the endosomal membrane during entry into host cell and might contribute to virus transport to the nucleus. |
| Subcellular Location | Virion. Host nucleus. |
| Protein Families | Parvoviridae capsid protein family |
| Database References | KEGG: vg:1489595 |
Gene Functions References
- Data show the expressed VP2 caspid protein was secreted on the cell surface in Lactobacillus casei. PMID: 17460908
