Recombinant Pongo Abelii Lysosome-Associated Membrane Glycoprotein 5 (LAMP5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07653P
Greater than 90% as determined by SDS-PAGE.
Recombinant Pongo Abelii Lysosome-Associated Membrane Glycoprotein 5 (LAMP5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07653P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Pongo Abelii Lysosome-Associated Membrane Glycoprotein 5 (LAMP5) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q5R5V2 |
Target Symbol | LAMP5 |
Synonyms | Brain and dendritic cell-associated LAMP Brain-associated LAMP-like protein |
Species | Pongo abelii (Sumatran orangutan) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVGRCGHSESELQVFWVDRAYALKMLFVKESHNMSKGPEETWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCAVDEREQLEE |
Expression Range | 30-234aa |
Protein Length | Partial |
Mol. Weight | 28 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain. |
Subcellular Location | Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Cell membrane; Single-pass type I membrane protein. Cell projection, dendrite. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type I membrane protein. Cell projection, growth cone membrane; Single-pass type I membrane protein. Early endosome membrane; Single-pass type I membrane protein. Recycling endosome. Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. |
Protein Families | LAMP family |
Database References | KEGG: pon:100173676 UniGene: Pab.2703 |