Recombinant Plasmodium Falciparum Plasmepsin I (PF14_0076) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03765P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Plasmodium falciparum (isolate 3D7) PF14_0076.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Plasmodium falciparum (isolate 3D7) PF14_0076.
Recombinant Plasmodium Falciparum Plasmepsin I (PF14_0076) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03765P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Plasmodium Falciparum Plasmepsin I (PF14_0076) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q7KQM4 |
| Target Symbol | PF14_0076 |
| Synonyms | PF14_0076; Plasmepsin-1; EC 3.4.23.38; Aspartic hemoglobinase I; PfAPG |
| Species | Plasmodium falciparum (isolate 3D7) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL |
| Expression Range | 125-452aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 52.9kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | During the asexual blood stage, catalyzes the initial cleavage of native host hemoglobin (Hb) resulting in Hb denaturation; specifically cleaves between Phe-33 and Leu-34 of Hb alpha-chain. Digestion of host Hb is an essential step which provides the parasite with amino acids for protein synthesis, and regulates osmolarity. |
| Subcellular Location | Membrane; Single-pass type II membrane protein. Vacuole lumen. Vacuole membrane. |
| Protein Families | Peptidase A1 family |
| Database References | KEGG: pfa:PF14_0076 |
Gene Functions References
- mtPM I exhibits kinetic parameters comparable to native PM I PMID: 18073224
