Recombinant Plasmodium Falciparum Merozoite Surface Protein 2 (MSP2) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08550P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Plasmodium Falciparum Merozoite Surface Protein 2 (MSP2) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08550P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Plasmodium Falciparum Merozoite Surface Protein 2 (MSP2) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P50498
Target Symbol MSP2
Synonyms MSA2; PFB0300c; Merozoite surface antigen 2; MSA-2; 45 kDa merozoite surface antigen
Species Plasmodium falciparum (isolate 3D7)
Expression System E.coli
Tag N-GST
Target Protein Sequence NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Expression Range 109-246aa
Protein Length Partial
Mol. Weight 41.7kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function May play a role in the merozoite attachment to the erythrocyte.
Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor.
Database References

Gene Functions References

  1. Genetic polymorphism of Merozoite Surface Protein-2 (MSP-2) in Plasmodium falciparum isolates from Pawe District, North West Ethiopia PMID: 28542247
  2. msp2 genetic profiles iof solates collected from successive malaria episodes in ten children who had four or more clinical episodes during follow up PMID: 23217196
  3. MSP2 Antigenic differences characterized via epitope mapping; results show that there are significant conformational differences between the two forms of MSP2 PMID: 22966050
  4. Allele typing of the msp2 gene detected 55% and 45% of 3D7 and FC27 allelic families in Plasmodium falciparum field isolates from Congolese children with asymptomatic infections. PMID: 22463364
  5. The majority of patients from all the five sites had mean monoclonal infections of 67.1 and 60.4% of P. falciparum for msp-1 and msp-2, respectively, whereas, mean multiple genotypes of 32.8 and 39.5% for msp-1 and msp-2, respectively. PMID: 22325817
  6. the helical structure of the N-terminal region of Plasmodium falciparum merozoite surface protein 2 has a role in fibril formation and membrane interaction PMID: 22304430
  7. Field isolates are highly diverse in respect of MSP2 and multiplicity of infection was neither age nor parasite density dependent in the study population. PMID: 21809706
  8. We tested the hypothesis that sequence diversity in MSP2 renders parasites bearing heterologous MSP2 alleles differentially susceptible to Fc-dependent functions of allele-specific MSP2 antibodies PMID: 21189324
  9. roles of individual residues in fibril formation and local ordered structure in two peptides, a recombinant 25-residue peptide corresponding to the entire N-terminal domain of mature MSP2 and an 8-residue peptide from the central region of this domain PMID: 20542076
  10. Extensive genetic polymorphism with diverse allele types was identified in MSP-1 and MSP-2 in P. falciparum field isolates from Myanmar. PMID: 20478015
  11. reports the functional properties of polyclonal and monoclonal antibodies induced by site-directed designed MSP-2 N-terminus pseudopeptides and their capacity for antibody isotype switching in in vitro immunization PMID: 17881088
  12. The two major complications seen in the subjects, cerebral malaria and severe anaemia, were each found to be significantly associated with the 3D7 subtype of msp-2 PMID: 18577328
  13. analysis of selective pressures on the merozoite surface protein 2 locus of Plasmodium falciparum PMID: 18840512
  14. current and comprehensive information on the diversity in the gene that encodes the merozoite surface protein (MSP) 1 and 2 and its implications on the epidemiology of malaria, immunity and development of control measures [review] PMID: 19326702
  15. MSP2 oligomers containing intermolecular beta-strand interactions similar to those in amyloid fibrils. PMID: 19450733

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed