Recombinant Pig Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00265P
Greater than 85% as determined by SDS-PAGE.
Recombinant Pig Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00265P
Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Cytokines, Cytokines and growth factors, Featured cd protein molecules, Featured immune checkpoint protein molecules, Immune checkpoint proteins, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Pig Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q8SQ34 |
Target Symbol | CD40 |
Species | Sus scrofa (Pig) |
Expression System | E.coli |
Tag | C-6His |
Target Protein Sequence | EPPTSCKENQYPTNSRCCNLCPPGQKLVNHCTEVTETECLPCSSSEFLATWNREKHCHQHKYCDPNLGLQVQREGTSKTDTTCVCSEGHHCTNSACESCTLHSLCFPGLGVKQMATEVSDTICEPCPVGFFSNVSSASEKCQPWTSCESKGLVEQRAGTNKTDVVCGFQSRMRA |
Expression Range | 21-194aa |
Protein Length | Partial |
Mol. Weight | 26.0 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References |
Gene Functions References
- These results therefore may help understand the molecular mechanism of CD40L signaling that contributes to the pathophysiology of atherosclerosis. PMID: 16677604
- This study shows that xenogeneic interaction between hCD40L and pCD40 can activate porcine endothelial cells through NF-kappaB signaling. PMID: 17675236
- The appearance of CD25 after activation of porcine dendritic cells, is reported. PMID: 19036453