Recombinant Pig Rhodopsin (RHO) Protein (GST&His)
Beta LifeScience
SKU/CAT #: BLC-08075P
Greater than 85% as determined by SDS-PAGE.
Recombinant Pig Rhodopsin (RHO) Protein (GST&His)
Beta LifeScience
SKU/CAT #: BLC-08075P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Pig Rhodopsin (RHO) Protein (GST&His) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O18766 |
Target Symbol | RHO |
Synonyms | RHO; RHO1; Rhodopsin |
Species | Sus scrofa (Pig) |
Expression System | Mammalian cell |
Tag | N-GST&C-6His |
Target Protein Sequence | MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ |
Expression Range | 1-36aa |
Protein Length | Partial |
Mol. Weight | 34.2 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling. |
Subcellular Location | Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. |
Protein Families | G-protein coupled receptor 1 family, Opsin subfamily |
Database References |
Gene Functions References
- the rhodopsin is densely packed in the retina and the rhodopsin molecules are not aligned well. PMID: 22842041
- Phototransduction, even when initiated by wild type rhodopsin, is altered in a way progressive with level of retinal degeneration. A model introduces idea of binding site for carboxy terminus of rhodopsin on rhodopsin kinase. PMID: 16402026