Recombinant Pig IFN omega 7 Protein
Beta LifeScience
SKU/CAT #: BLA-0933P
Recombinant Pig IFN omega 7 Protein
Beta LifeScience
SKU/CAT #: BLA-0933P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Accession | B3VSD1 |
Description | Recombinant Pig IFN omega 7 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | GSLGCDLSQNHVHISRKNLVLLHQMRRISPSFCLKDRKDFGLPQEMVDGS HLQKAQAISVLHEMLQQTFLLFHIKRSSAAWDSILLDKLHSGLHQQLEDL DPCLVQEMGEQASALGMAMKKYFQGIHLYLKEKKYSDCAWEIVRVEIMRA LSFSTNLQERLRIMDEHLGSP |
Molecular Weight | 20 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |