Recombinant Pig Calcium-Activated Chloride Channel Regulator 1 (CLCA1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08671P
Greater than 85% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Recombinant Pig Calcium-Activated Chloride Channel Regulator 1 (CLCA1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08671P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Pig Calcium-Activated Chloride Channel Regulator 1 (CLCA1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9TUB5 |
| Target Symbol | CLCA1 |
| Synonyms | CLCA1; AECCCalcium-activated chloride channel regulator 1; EC 3.4.-.-; Calcium-activated chloride channel family member 1; pCLCA1 |
| Species | Sus scrofa (Pig) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ |
| Expression Range | 46-199aa |
| Protein Length | Partial |
| Mol. Weight | 22.8 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells. |
| Subcellular Location | Secreted, extracellular space. |
| Protein Families | CLCR family |
| Database References | KEGG: ssc:397284 STRING: 9823.ENSSSCP00000007392 UniGene: PMID: 19755716 |
