Recombinant Phoneutria Nigriventer Omega-Ctenitoxin-Pn3A (OMEGA-CNTX-PN3A) Protein (His&Myc)

Name: Recombinant Phoneutria Nigriventer Omega-Ctenitoxin-Pn3A (OMEGA-CNTX-PN3A) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-07253P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Phoneutria Nigriventer Omega-Ctenitoxin-Pn3A (OMEGA-CNTX-PN3A) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P81790
Target Symbol	P81790
Species	Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	SCINVGDFCDGKKDDCQCCRDNAFCSCSVIFGYKTNCRCEVGTTATSYGICMAKHKCGRQTTCTKPCLSKRCKKNH
Expression Range	40-115aa
Protein Length	Full Length of Mature Protein
Mol. Weight	15.8 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	This toxin is a potent and practically irreversible antagonist of both Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channels, while it displays a partial and rapidly reversible block of Cav2.3/CACNA1E calcium channels and no effect on Cav3/CACNA1 calcium channels. Inhibits glutamate uptake from rat brain synaptosomes by an interaction between cysteines from both glutamate transporter and toxin. Blocks potassium-induced exocytosis of synaptic vesicles in brain cortical synaptosomes with an IC(50) of 1.1 nM. In mice, induces rapid general flaccid paralysis followed by death in 10-30 minutes at dose levels of 5 ug per mouse. In rat brain, inhibits glutamate release, neuronal death and loss of neurotransmission in the hippocampus resulting from ischemia.
Subcellular Location	Secreted.
Protein Families	Omega-agatoxin superfamily, Type II/III omega-agatoxin family
Tissue Specificity	Expressed by the venom gland.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.