Recombinant Phoneutria Nigriventer Delta-Ctenitoxin-Pn1A (PNTX4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10565P
Greater than 90% as determined by SDS-PAGE.
Recombinant Phoneutria Nigriventer Delta-Ctenitoxin-Pn1A (PNTX4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10565P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Phoneutria Nigriventer Delta-Ctenitoxin-Pn1A (PNTX4) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P59368 |
| Target Symbol | PNTX4 |
| Synonyms | ; Delta-ctenitoxin-Pn1a; Delta-CNTX-Pn1a; Insecticidal neurotoxin Tx4(6-1); PnTx4(6-1) |
| Species | Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC |
| Expression Range | 35-82aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 7.3kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin also inhibits glutamate uptake from rat brain synaptosomes. It reversibly inhibits the N-methyl-D-aspartate (NMDA)-subtype of ionotropic glutamate receptor (GRIN). In addition, the toxin shows antinociceptive effect in all rat pain models tested (inflammatory, neuropathic and nociceptive). The antinociceptive effect is partially blocked when selective antagonists of both mu- and delta-opioid receptors are administered, revealing that the antinociceptive effect of the toxin involves both opiod and cannabinoid endogenous systems. In vivo, it is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice. |
| Subcellular Location | Secreted. |
| Protein Families | Spider toxin Tx2 family |
| Tissue Specificity | Expressed by the venom gland. |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
