Recombinant Oryza Sativa Subsp. Japonica Mitogen-Activated Protein Kinase 5 (MPK5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02557P
Greater than 85% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Oryza sativa subsp. japonica (Rice) MPK5.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Oryza sativa subsp. japonica (Rice) MPK5.
Recombinant Oryza Sativa Subsp. Japonica Mitogen-Activated Protein Kinase 5 (MPK5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02557P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Oryza Sativa Subsp. Japonica Mitogen-Activated Protein Kinase 5 (MPK5) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q10N20 |
| Target Symbol | MPK5 |
| Synonyms | MPK5; BIMK1; MAPK2; MAPK5; MPK3; MSRMK2; Os03g0285800; LOC_Os03g17700; OsJ_10412; OSJNBa0013D02.9; Mitogen-activated protein kinase 5; MAP kinase 5; EC 2.7.11.24; Benzothiadiazole-induced MAP kinase 1; MAP kinase 2; Multiple stress-responsive MAP kinase 2; OsBIMK1; OsMAP1; OsMAPK2; OsMAPK5; OsMPK3; OsMSRMK2 |
| Species | Oryza sativa subsp. japonica (Rice) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAALDLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLIFNEAIEMNPNIRY |
| Expression Range | 1-369aa |
| Protein Length | Full Length |
| Mol. Weight | 48.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in disease resistance and abiotic stress tolerance signaling pathways. Acts as a positive regulator of drought, salt and cold tolerance. Negatively modulates pathogenesis-related (PR) gene expression and broad-spectrum disease resistance. Functions downstream of CPK18 in a signaling pathway that represses defense gene expression and negatively regulates resistance to rice blast fungus. Phosphorylated by CPK18 at Thr-14 and Thr-32 and activated independently of MAP kinase kinase (MKK) phosphorylation. |
| Subcellular Location | Nucleus. Cytoplasm. |
| Protein Families | Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily |
| Database References |
