Recombinant Oncorhynchus Mykiss Cytochrome P450 1A1 (CYP1A1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00173P
Greater than 85% as determined by SDS-PAGE.
Recombinant Oncorhynchus Mykiss Cytochrome P450 1A1 (CYP1A1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00173P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Oncorhynchus Mykiss Cytochrome P450 1A1 (CYP1A1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Activity | Not tested. |
| Uniprotkb | Q92110 |
| Target Symbol | CYP1A1 |
| Synonyms | (CYP1A2)(CYPIA1) |
| Species | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SFATLEGTTPEYSCALEEHVCKEGEYLVKQLTSVMDVSGSFDPFRHIVVSVANVICGMCFGRRYSHDDQELLGLVNMSDEFGQVVGSGNPADFIPILRYLPNRTMKRFMDINDRFNNFVQKIVSEHYESYDKDNIRDITDSLIDHCEDRKLDENANIQVSDEKIVGIVNDLFGAGFDTISTALSWAVVYLVAYPEIQERLHQELKEKVGMIRTPRLSDKINLPLLEAFILEIFRHSSFLPFTIPHCTIKDTSLNGYFIPKDTCVFINQWQVNHDPELWKEPSSFNPDRFLSADGTELNKLEGEKVLVFGMDKRRCIG |
| Expression Range | 149-465aa |
| Protein Length | Partial |
| Mol. Weight | 43.7 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytochromes P450 are a group of heme-thiolate monooxygenases. They oxidize a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. |
| Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
| Protein Families | Cytochrome P450 family |
| Database References | UniGene: Omy.11738 |
| Tissue Specificity | Liver. |
