Recombinant Neisseria Meningitidis Serogroup B Penicillin-Binding Protein 1A (MRCA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02622P

Greater than 90% as determined by SDS-PAGE.
Recombinant Neisseria Meningitidis Serogroup B Penicillin-Binding Protein 1A (MRCA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02622P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Neisseria Meningitidis Serogroup B Penicillin-Binding Protein 1A (MRCA) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P0A0Z6 |
Target Symbol | MRCA |
Synonyms | mrcA; ponA; NMB1807; Penicillin-binding protein 1A; PBP-1a; PBP1a) [Includes: Penicillin-insensitive transglycosylase; EC 2.4.1.129; Peptidoglycan TGase); Penicillin-sensitive transpeptidase; EC 3.4.16.4; DD-transpeptidase)] |
Species | Neisseria meningitidis serogroup B (strain MC58) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW |
Expression Range | 206-413aa |
Protein Length | Partial |
Mol. Weight | 40.0kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). |
Subcellular Location | Cell inner membrane; Single-pass type II membrane protein. |
Protein Families | Glycosyltransferase 51 family; Transpeptidase family |
Database References | KEGG: nme:NMB1807 STRING: 122586.NMB1807 |