Recombinant Naja Atra Cytotoxin 2 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01673P
Greater than 85% as determined by SDS-PAGE.
Recombinant Naja Atra Cytotoxin 2 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01673P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Naja Atra Cytotoxin 2 Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P01442 |
| Target Symbol | P01442 |
| Synonyms | Cardiotoxin 1A;Cardiotoxin 2;CTX-2;Cardiotoxin A2;CTX A2;Cardiotoxin II;Cardiotoxin analog II |
| Species | Naja atra (Chinese cobra) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN |
| Expression Range | 22-81aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 14.2 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Basic protein that binds to cell membrane and depolarizes cardiomyocytes. It also shows lytic activities, but 2-fold less important than that of CTX-A4. It binds to the integrin alpha-V/beta-3 (ITGAV/ITGB3) with a moderate affinity. It may interact with sulfatides in the cell membrane which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induce mitochondrial swelling and fragmentation. |
| Subcellular Location | Secreted. Target cell membrane. |
| Protein Families | Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily |
| Tissue Specificity | Expressed by the venom gland. |
