Recombinant Mycobacterium Tuberculosis Steroid C26-Monooxygenase (CYP125) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09629P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mycobacterium Tuberculosis Steroid C26-Monooxygenase (CYP125) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09629P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mycobacterium Tuberculosis Steroid C26-Monooxygenase (CYP125) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P9WPP1 |
| Target Symbol | CYP125 |
| Synonyms | cyp125; cyp125A1; Rv3545c; MTCY03C7.11Steroid C26-monooxygenase; EC 1.14.15.29; Cholest-4-en-3-one 26-monooxygenase; Cholest-4-en-3-one C26-monooxygenase [(25S)-3-oxocholest-4-en-26-oate forming]; Cholesterol C26-monooxygenase; Cholesterol C26-monooxygenase [(25S)-3beta-hydroxycholest-5-en-26-oate forming]; Cytochrome P450 125; Steroid C27-monooxygenase |
| Species | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH |
| Expression Range | 1-433aa |
| Protein Length | Full Length |
| Mol. Weight | 50.4kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in the utilization of cholesterol as the sole carbon and energy source by degrading the side chain during infection. Primarily catalyzes the sequential oxidation of the terminal methyl of cholest-4-en-3-one into (25S)-26-hydroxycholest-4-en-3-one (alcohol), (25S)-26-oxocholest-4-en-3-one (aldehyde), to finally yield the carboxylic acid (25S)-3-oxocholest-4-en-26-oate. Also able to sequentially oxidize cholesterol itself, not only cholest-4-en-3-one. |
| Protein Families | Cytochrome P450 family |
| Database References | KEGG: mtu:Rv3545c STRING: 83332.Rv3545c |
Gene Functions References
- M. tuberculosis cytochrome P450 Cyp125 plays a key role in cholesterol metabolism being involved in the first steps of its degradation PMID: 26197389
- Drug modulation of water-heme interactions in low-spin P450 complexes of CYP2C9d and CYP125A1. PMID: 25591012
- CYP125A1 plays a crucial role in circumventing the deleterious effect of cholest-4-en-3-one. PMID: 20545858
- Reactive nitrogen species (*NO) produced by host macrophages binds to CYP125 in its ferric state; a role for *NO in inhibition of cytochrome P450 activities in dormant mycobacterial cells is conceivable. PMID: 19146393
- Mycobacterial cytochrome p450 125 (cyp125) catalyzes the terminal hydroxylation of c27 steroids. PMID: 19846551
- The Structure of Mycobacterium tuberculosis CYP125: molecular basis for cholesterol binding in a P450 needed for host infection. PMID: 19846552
