Recombinant Mycobacterium Tuberculosis Immunogenic Protein Mpt64 (MPT64) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02059P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mycobacterium Tuberculosis Immunogenic Protein Mpt64 (MPT64) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02059P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mycobacterium Tuberculosis Immunogenic Protein Mpt64 (MPT64) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P9WIN9 |
| Target Symbol | MPT64 |
| Synonyms | mpt64; MT2032; Immunogenic protein MPT64; Antigen MPT64 |
| Species | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA |
| Expression Range | 24-228aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 26.4kDa |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Subcellular Location | Secreted. |
| Database References | KEGG: mtu:Rv1980c STRING: 83332.Rv1980c |
Gene Functions References
- Aptamers against Mtb secreted protein MPT64 were successfully selected and could be used as an alternative for detection and diagnosis of tuberculosis. PMID: 28454652
- we found that polymorphisms of the mpt64 gene in the MTBC may be the reason for changes in the antigen produced, which may in turn cause alterations of related functions, thereby allowing immune evasion. PMID: 23390287
- CFP21 (cutinase precursor) and MPT64 fusion protein stimulate higher level of interferon (IFN)-gamma in tuberculin skin test (TST)-positive healthy population than in TST-negative healthy population. PMID: 21340709
- Data show that Recombinant Mycobacterium vaccae secreted MPT64 could induce high level humoral and cell mediated immune responses in mice and could be used as a candidate of new vaccine against TB. PMID: 19257983
- Recombinant rMPT64 elicits a specific immune response indistinguishable from that of MPB64 purified from BCG Tokyo culture filtrates. PMID: 16216527
