Recombinant Mycobacterium Tuberculosis Hypoxic Response Protein 1 (HRP1) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02594P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1.
Recombinant Mycobacterium Tuberculosis Hypoxic Response Protein 1 (HRP1) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02594P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mycobacterium Tuberculosis Hypoxic Response Protein 1 (HRP1) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P9WJA3 |
| Target Symbol | HRP1 |
| Synonyms | hrp1; Rv2626cHypoxic response protein 1; HRP1 |
| Species | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS |
| Expression Range | 1-143aa |
| Protein Length | Full Length |
| Mol. Weight | 35.5kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Unlike some other CBS-domain containing proteins does not seem to bind AMP. |
| Subcellular Location | Secreted. Note=Not seen to be associated with the cell wall. |
| Database References | KEGG: mtu:Rv2626c STRING: 83332.Rv2626c |
Gene Functions References
- Mycobacterium tuberculosis protein Rv2626c plays a significant role in stimulating macrophages to provoke a pro-inflammatory response and in mycobacterial survival during infection. PMID: 28671529
- Rv2626c \appears to modulate macrophage effector functions by eliciting both innate and adaptive immune responses PMID: 20201990
