Recombinant Mycobacterium Tuberculosis Esat-6-Like Protein Esxh (ESXH) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04257P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mycobacterium Tuberculosis Esat-6-Like Protein Esxh (ESXH) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04257P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mycobacterium Tuberculosis Esat-6-Like Protein Esxh (ESXH) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P9WNK2 |
| Target Symbol | ESXH |
| Synonyms | esxH; cfp7; MT0301ESAT-6-like protein EsxH; 10 kDa antigen CFP7; CFP-7; Low molecular weight protein antigen 7; Protein TB10.4 |
| Species | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG |
| Expression Range | 2-96aa |
| Protein Length | Partial |
| Mol. Weight | 26.3kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | EsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery. |
| Subcellular Location | Secreted. |
| Protein Families | WXG100 family, ESAT-6 subfamily |
| Database References | KEGG: mtc:MT0301 |
