Recombinant Mycobacterium Tuberculosis Diacylglycerol Acyltransferase/Mycolyltransferase Ag85A (FBPA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04808P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mycobacterium Tuberculosis Diacylglycerol Acyltransferase/Mycolyltransferase Ag85A (FBPA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04808P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mycobacterium Tuberculosis Diacylglycerol Acyltransferase/Mycolyltransferase Ag85A (FBPA) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P9WQP2 |
| Target Symbol | FBPA |
| Synonyms | fbpA; mpt44; MT3911Diacylglycerol acyltransferase/mycolyltransferase Ag85A; DGAT; EC 2.3.1.122; EC 2.3.1.20; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; 85A; Ag85A; Fibronectin-binding protein A; Fbps A |
| Species | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA |
| Expression Range | 44-338aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 44.6 kDa |
| Research Area | Microbiology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor. |
| Subcellular Location | Secreted, cell wall. Cytoplasm. |
| Protein Families | Mycobacterial A85 antigen family |
| Database References | KEGG: mtc:MT3911 |
